KEGG   Tribolium castaneum (red flour beetle): 660201Help
Entry
660201            CDS       T01046                                 

Definition
(RefSeq) aldose 1-epimerase
  KO
K01785  aldose 1-epimerase [EC:5.1.3.3]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00010  Glycolysis / Gluconeogenesis
tca00052  Galactose metabolism
tca01100  Metabolic pathways
Module
tca_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    660201
   00052 Galactose metabolism
    660201
Enzymes [BR:tca01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.3  aldose 1-epimerase
     660201
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Aldose_epim Soyouz_module
Motif
Other DBs
NCBI-GeneID: 660201
NCBI-ProteinID: XP_971548
UniProt: D6WGD2
Position
LG3
AA seq 356 aa AA seqDB search
MVKLTDDQFDLYTCTSTGKSIPVRRFTWTNQSKISVQVITYGATTTSIKIPDKKGVIKDI
VGGGNTIEEYQKAQVYFGATVGRVANRIANGQFKLFDQTINLSKNHGKHQLHGGFLGFDK
VIWESYVSGNRVVMSYHSADLEEGYPGDVVVNATFELTENNEFLVEYKATTTKPTYVNLT
NHSYFNLAGHEAGASELYKHVICINADRITDVDTDCIPTGKLLPVANTVFDLQIPKSLGD
IIAKVPKSDGFDHNFCVNKGTEQGTAFVGRAYHPDSGRMLEVYSNQPGVQFYTANFFPEN
PKILSGKGASYCKHGAFCLETQNWPDAPNHDNFPKMILVPGETYCHNVAYKFSVKN
NT seq 1071 nt NT seq  +upstreamnt  +downstreamnt
atggtaaaactaacagacgaccagttcgatttgtacacttgcacaagcactggaaagtcc
attccagtccgccgtttcacttggacaaaccaaagcaagatatccgtgcaagtcattact
tatggagcgactacaacgtccataaaaattcccgacaaaaagggggttatcaaagacatc
gtggggggcggcaacacaatcgaagagtaccaaaaagcccaagtttactttggcgcaacc
gtgggccgcgtcgccaacagaatcgcaaacggccagttcaaacttttcgatcagacaatc
aatctaagcaaaaatcatggcaagcaccaattgcacggcggcttcctcggctttgataaa
gttatttgggagagctacgtcagtggtaacagggtagtgatgagttaccactcggccgat
ctcgaggaaggctaccctggcgatgttgtggtaaacgctacgtttgaactaacggaaaac
aacgagtttttggtcgagtataaggccacaactactaaaccgacttatgtcaatctgaca
aaccactcgtacttcaatttggccggtcacgaagctggggctagtgaactttacaaacat
gttatttgcataaatgcagaccgaataactgacgttgacactgactgtattcccactgga
aagttactaccagtggctaacactgtatttgatttacaaattcccaaaagcctcggcgat
atcatcgccaaagtccccaaaagcgacggttttgaccacaatttttgcgtcaataaaggc
acagagcaaggaactgcattcgttggaagggcttaccaccctgacagtggccggatgctg
gaagtgtacagtaaccaacccggagtgcagttttacaccgcgaattttttccccgaaaat
ccgaagattttgtcaggcaaaggcgcttcgtattgcaaacatggagctttctgtttggaa
acgcaaaattggcctgatgctcccaatcatgataatttccccaagatgattttggtgccc
ggtgagacttattgtcacaacgtggcttacaaattctccgtgaagaattaa

DBGET integrated database retrieval system