KEGG   Tribolium castaneum (red flour beetle): 660255Help
Entry
660255            CDS       T01046                                 

Definition
(RefSeq) methionine--tRNA ligase, mitochondrial
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00450  Selenocompound metabolism
tca00970  Aminoacyl-tRNA biosynthesis
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    660255
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    660255
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tca01007]
    660255
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tca03016]
    660255
Enzymes [BR:tca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     660255
Amino acid related enzymes [BR:tca01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   660255
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    660255
 Prokaryotic type
   Other AARSs
    660255
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA-synt_1 tRNA-synt_1e Anticodon_1 tRNA-synt_1f S6PP_C
Motif
Other DBs
NCBI-GeneID: 660255
NCBI-ProteinID: XP_015838800
Position
LG9
AA seq 528 aa AA seqDB search
MKKRELGGPHIGHLYSSVIADALYRWQQVLGAGKFKFSTGTDEHGSKIQQAAHKNNTNPS
DYCTRVSSDYKRLSEVFSISYTDFVRTSDEEHKKCVHKFWNVLKNKGKIFSSKYAGWYCI
SDESFLTESQLKEKVGPDGRKTIISGESGHPVEWIEEVNYMFPLGSLQDDVKYWLRSENA
VRPAKFQKILLDMVSKGPLPDISISRPASRVHWGIQVPDDETQTVYVWLDALVNYLTAAG
YSHASLHQIWPPSVQVIGKDILKFHGIYWPSFLIAAGLDPPLSILCHSHWTVDGEKMSKS
KNNVVCPFQRSEIYSSDGLRYFLLREGVAHSDGNYSDTKVIRILNSELADTLGNLLSRCC
GTALNPHQTFPKIEASAFESVASSDVTKKLIEDVATLPDVCMGHYSNFNFYKAVDRVIAT
LHQANLFFETFKPWELKKESAKTRELDVVLHLTLETLRVCGILLQPIIPNIASNLLNKIN
VARERRTFSDAKILSWDDTNFVRKELAKDKTLLFKRIVLEGDRKKTKQ
NT seq 1587 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagagggaactaggcggcccccacattggtcatttgtacagttctgtgatcgcc
gacgcgctttataggtggcagcaggtgctcggcgcgggtaaatttaaattttcaacaggt
accgacgaacacggttcaaagattcaacaagcggctcataaaaacaacacaaatccttcc
gattattgtacgagagtgtcgagtgactataaaaggttgagtgaagtgtttagtatcagt
tacaccgatttcgtgaggacctcggatgaggagcacaagaaatgcgttcataaattttgg
aacgttttgaagaataagggcaaaatcttctcgtcgaaatatgcgggttggtactgcatt
tcagacgagtcgtttctaactgaatcccagttgaaagaaaaagtcggaccggatggtcgt
aaaacaattatatccggggaaagcggtcatccagtcgagtggatcgaggaggtgaactat
atgtttccgcttgggtctttgcaagacgacgttaaatattggctcaggagcgagaatgcg
gttagaccggcaaagtttcaaaagattttgctggatatggtcagcaagggccctttaccg
gacatttcaatatcgaggccggcgtctcgggtgcactggggcatacaagtaccggacgac
gaaactcaaacggtttacgtatggctggacgccctcgtcaactatttaaccgccgccgga
tattcgcatgcgagtttacaccaaatttggcctcccagcgtccaagttatcggcaaggac
attctcaagtttcacgggatttattggccctcttttttgatcgccgctggtttagatccc
cccctgtcgattttatgtcactcgcattggaccgtcgatggcgaaaaaatgtccaagtcg
aaaaacaacgtcgtttgtccgttccaaagaagtgaaatatactccagcgacggtctccgc
tactttttactgcgcgaaggtgtcgcacacagtgacggtaattacagcgacacgaaagtc
atccgcatcttgaattcggaattggccgatactttgggtaatttattgagtcggtgctgc
ggaactgccctaaatcctcatcagacgtttccgaaaatcgaagcttcggccttcgaaagc
gtcgcctcatccgacgtgacgaagaagttaatcgaagacgtcgccacgcttccagacgtt
tgtatgggtcattactctaactttaacttctataaggccgtggatagggtaatagcaact
cttcatcaagcgaatttgttctttgaaactttcaagccttgggaattgaaaaaagaatcg
gccaagacgagggagttggacgtcgtcttgcatttaactttagaaactttgagggtttgc
gggattttgctgcaacctattattccgaatatagcgtctaatttattaaataaaatcaat
gtggcgagagagagacgaacttttagcgacgccaagatattatcatgggacgataccaac
ttcgtccgcaaggaattagccaaggataagacgctcttgttcaaacggatcgttctagaa
ggcgacaggaagaaaaccaaacaatga

DBGET integrated database retrieval system