KEGG   Tribolium castaneum (red flour beetle): 660433Help
Entry
660433            CDS       T01046                                 

Definition
(RefSeq) enoyl-CoA hydratase, mitochondrial
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00062  Fatty acid elongation
tca00071  Fatty acid degradation
tca00280  Valine, leucine and isoleucine degradation
tca00310  Lysine degradation
tca00380  Tryptophan metabolism
tca00410  beta-Alanine metabolism
tca00640  Propanoate metabolism
tca00650  Butanoate metabolism
tca01100  Metabolic pathways
tca01200  Carbon metabolism
tca01212  Fatty acid metabolism
Module
tca_M00013  Malonate semialdehyde pathway, propanoyl-CoA => acetyl-CoA
tca_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tca_M00085  Fatty acid biosynthesis, elongation, mitochondria
tca_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tca00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    660433
   00650 Butanoate metabolism
    660433
  Lipid metabolism
   00062 Fatty acid elongation
    660433
   00071 Fatty acid degradation
    660433
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    660433
   00310 Lysine degradation
    660433
   00380 Tryptophan metabolism
    660433
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    660433
Enzymes [BR:tca01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     660433
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49
Motif
Other DBs
NCBI-GeneID: 660433
NCBI-ProteinID: XP_971757
Position
LG8
AA seq 325 aa AA seqDB search
MTNFAVYRVADKQAKTLNRFNKFLSINTVTMAAKSLARFVVSRISTPASNKAFLNNPNIK
FYSVQKNFEFIKTHKAGARNNVGVITLNRPKALNALCNGLMQEVADALDVFEKDNDVGAI
IITGSEKAFAAGADIKEMQNNTYSQCVRGNFLAHWNRVSESVKPVIAAVNGYALGGGCEL
AMMCDIIYAGENAKFGQPEILIGTIPGAGGTQRLTRVVGKSKAMEMVLTGDQVPAHEAEK
MGLVSKVFPVEKLMDETVKLAEKIAKNSHLVNGMCKESVNTAYETTLREGLHFEKRMFHG
TFATKDRKEGMTAFIEKRAPNFTNE
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgaccaactttgctgtttaccgggttgctgataaacaggcaaagactttgaaccggttt
aacaaatttttatctattaacacagtgacaatggcagcgaaaagtttggctcggtttgtg
gtctccagaatttccacccccgcctccaacaaggcattccttaacaaccccaacatcaaa
ttctacagcgttcaaaaaaacttcgaatttattaaaacgcacaaagctggggcccgcaac
aatgtgggggtgattactctgaaccggccaaaggcccttaatgccctttgcaacggcttg
atgcaggaagttgccgacgctttggacgtgtttgagaaggacaacgacgtgggggctatc
ataatcaccggtagcgaaaaggcctttgctgcaggtgccgacatcaaagaaatgcaaaac
aacacttattcgcaatgcgttcggggcaactttttggcccattggaaccgcgtctctgag
agcgtgaagccggtgattgctgccgtcaacggctacgctctggggggcggttgcgagctg
gccatgatgtgcgacatcatctacgcaggcgagaatgccaagtttgggcaaccggagatc
ttgattgggaccattccgggggctgggggcacccagaggttgacgagggttgtggggaag
tccaaggctatggagatggtgctcacgggggatcaagtgccggcgcacgaggccgagaag
atgggtctggtcagtaaagtcttcccggttgagaaactgatggacgaaacggtcaaacta
gcggagaaaattgcgaaaaattcgcacctagttaacggaatgtgcaaggagtcggtcaat
acagcgtacgaaacgacgctcagagaggggctccacttcgagaaacggatgttccacggg
accttcgctactaaagaccgcaaagaaggaatgactgcttttattgagaaacgggccccg
aatttcacaaatgaataa

DBGET integrated database retrieval system