KEGG   Tribolium castaneum (red flour beetle): 660435
Entry
660435            CDS       T01046                                 
Name
(RefSeq) 60S ribosomal protein L11
  KO
K02868  large subunit ribosomal protein L11e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    660435
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    660435
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    660435
SSDB
Motif
Pfam: Ribosomal_L5 Ribosomal_L5_C tRNA_anti-like HTH_ABP1_N
Other DBs
NCBI-GeneID: 660435
NCBI-ProteinID: XP_971759
UniProt: D6WW88
Position
LG8:complement(7540655..7541805)
AA seq 190 aa
MAPVAKGAKKEKREVKDKSKNVMRDLHIRKLCLNICVGESGDRLTRAAKVLEQLTGQQPV
FSKARYTVRSFGIRRNEKIAVHCTVRGAKAEEILERGLKVREYELRRDNFSASGNFGFGI
QEHIDLGIKYDPSIGIYGLDFYVVLGRPGFNVAHRRRKQGKVGFPHRLTKEDAMKWFQQK
YDGIILASKK
NT seq 573 nt   +upstreamnt  +downstreamnt
atggcgccggtagcgaagggagcgaagaaggaaaagcgggaggtgaaggacaagtccaaa
aatgtgatgagggaccttcacatccgcaaactgtgcctaaatatttgcgtcggagagtct
ggtgataggttaacccgcgccgctaaagtgttagaacaattgacggggcaacagcccgtg
ttttccaaagcccgctacaccgtccggtctttcggcatcagacgtaacgaaaagatcgcc
gttcactgcacagtccgtggggccaaggccgaggagatcctcgaacggggcctgaaagtg
cgcgagtacgaattgagacgcgacaacttttccgcttcaggtaactttggcttcggtatc
caggaacacatcgatttggggatcaagtatgaccccagtattggtatctacggtttagat
ttttacgtcgttttgggacggcctggcttcaatgtcgcccacaggaggaggaaacaaggg
aaggttggattcccgcaccgtttgacgaaagaagacgccatgaagtggttccagcagaaa
tatgacggtataattctggcgagtaagaagtga

DBGET integrated database retrieval system