KEGG   Tribolium castaneum (red flour beetle): 660540
Entry
660540            CDS       T01046                                 

Name
(RefSeq) long-chain fatty acid transport protein 4
  KO
K08745  solute carrier family 27 (fatty acid transporter), member 1/4 [EC:6.2.1.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:tca01004]
    660540
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:tca02000]
    660540
Enzymes [BR:tca01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-  
     660540
Lipid biosynthesis proteins [BR:tca01004]
 Acyl-CoA synthetase
  Long/very long chain acyl-CoA synthetase
   660540
Transporters [BR:tca02000]
 Solute carrier family (SLC)
  SLC27: Fatty acid transporter
   660540
SSDB
Motif
Pfam: AMP-binding AMP-binding_C DUF2207
Other DBs
NCBI-GeneID: 660540
NCBI-ProteinID: XP_008193688
UniProt: D6WL30
Position
LG5:complement(8470629..8479826)
AA seq 699 aa
MDKKINGNAKICENRQSEDLESGKAAVGEESSRESATRHKSLKTRPVRVLIRRILVMTAI
VAVLVALSAVVCFFLGWKCLVQLILVAIVAYLAAGKWRWFYVALMTAPRDIKALYKYLRL
LIQIKSWQREDVTLADIFRRNVKRHPNKACILFEDQEWSFAQLEEYSNKVANVFKSHGYK
KGDVVALFLENRPEFIALWLGLSKLGVITPLINTNQRLDSLVHSITIAGSQAVIFGSDLS
DAIIDVFEKIEAKVTFYQLCITDKSNVDQRFRDLRQLINDAPPTPPSISEKLHHHDRLVY
IYTSGTTGLPKAAVISSSRYIFIAAAIHWLSGFKSSDCFYTPLPLYHTAGGCMSVGQMLI
YGATLVIRKKFSASAYFPDCEKYKCTIAQYIGEMCRYILAVPPKPSDTQHHLRMIYGNGL
RPQIWCEFVERFKIPKVAEFYGATEGNANIVNVDNTVGAIGFVSRIIPSVYPISIIKVDP
QTGEPIRNAHGLCVPCKPNEPGVFIGKIIPNNPSRAFLGYVDEEASKKKVVTDVFHRGDK
AFLSGDILVADEFGYLFFKDRTGDTFRWKGENVSTSEVEAVLSNVISYKDVVVYGVEIRG
VEGRAGMAAIFDPEGTVDLAQLAEGTKKALPFYARPIFIRILKKLDMTGTYKLKKNDLQK
EGFDVSKISDDIYYLDSKGTYSLVTPEVYQQINDGIIRV
NT seq 2100 nt   +upstreamnt  +downstreamnt
atggataaaaaaatcaacggcaacgcaaaaatttgcgaaaatcgccagtcggaggatttg
gagagcgggaaagcagcggtcggcgaggagtcaagtagagaaagcgccacgcgacacaaa
agcctgaagacaagaccagttcgtgtcctaatacggcggatactggtcatgacagcgata
gttgcagttttggtggctcttagtgccgttgtgtgtttcttcctaggctggaaatgtctg
gtacaattaattttagttgctatcgttgcgtaccttgccgctggaaagtggagatggttc
tacgtggcccttatgactgcccccagggacatcaaagctctctacaaatatctaagactc
ctaatccaaataaaatcatggcaaagagaggacgtaaccctggcggatatattccgccga
aacgtaaaaagacaccctaacaaagcctgcattcttttcgaagaccaagaatggtcgttt
gctcaactcgaagagtatagtaataaggtagccaacgtattcaaaagccacggctacaaa
aaaggcgacgttgtcgctttatttttggaaaatcggcccgagtttattgctctatggctc
ggtttatcgaaactaggtgttataacaccactaataaacaccaaccaaagactggattca
ctcgtacattccatcacaattgctggaagccaagccgtcattttcgggagtgatttatca
gatgcaataatcgatgttttcgaaaaaatcgaagccaaagtcaccttttaccagttgtgt
atcaccgacaaatcgaacgtcgatcaacgattccgcgacttgagacaactgatcaacgat
gcgcccccgacgccccccagcatatcggagaaactccaccatcatgacagattggtgtac
atttacacttcgggcaccaccggattgcccaaagctgcagtcatcagcagttcacgttac
atttttatcgctgctgcaattcattggctgtcggggttcaaaagctcggactgcttttat
acgccgttgccgttgtatcacactgccggaggatgcatgtcagttggacaaatgctgatt
tatggtgctactttagtcattaggaagaaattttcagcgtcagcttatttccccgactgc
gaaaaatacaaatgcacgattgctcagtacattggagagatgtgccgctacatcctcgcg
gtgccgccaaaaccctccgacacgcaacaccaccttcgaatgatatacggaaacggcctt
cggccgcaaatctggtgcgagttcgtcgaaagattcaaaatacccaaagtggccgaattt
tacggcgccactgaaggaaacgccaacattgtcaatgtggacaacactgtgggggcgatc
ggcttcgtctcgcgaatcattccttccgtgtacccaatctccatcataaaagtggacccg
cagacgggcgagcccatcagaaacgcccatgggctgtgcgtcccgtgcaaacccaacgag
ccgggcgttttcatcgggaaaatcatcccgaataacccatcgcgcgcgtttctgggctat
gtggacgaggaagcgtccaagaaaaaggtggtcacggatgtgttccatcgcggagataag
gcgttcttatcaggggatattctagtcgccgatgagtttgggtatttgttcttcaaggac
cggactggagatactttcaggtggaaaggcgagaatgtctcaacttcggaagttgaagca
gtattaagtaacgttatttcgtacaaagatgtggtagtgtacggggttgagattaggggc
gttgaggggagggccggaatggcggctatttttgatcctgagggaactgtggacctcgca
caactggcagaaggcaccaaaaaggcgctgccgttctatgctagaccgattttcattcga
attttgaagaagttagatatgacaggtacttacaagttgaagaaaaacgatctacaaaag
gaaggattcgatgttagcaaaataagcgacgatatttattatttggacagtaaaggcact
tattccttagtcacgccagaagtgtaccaacaaatcaatgacggaataatcagagtgtaa

DBGET integrated database retrieval system