KEGG   Tribolium castaneum (red flour beetle): 660646
Entry
660646            CDS       T01046                                 

Definition
(RefSeq) probable proline--tRNA ligase, mitochondrial
  KO
K01881  prolyl-tRNA synthetase [EC:6.1.1.15]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    660646
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tca01007]
    660646
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tca03016]
    660646
Enzymes [BR:tca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.15  proline---tRNA ligase
     660646
Amino acid related enzymes [BR:tca01007]
 Aminoacyl-tRNA synthetase
  Class II (C/G)
   660646
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    660646
 Prokaryotic type
    660646
SSDB
Motif
Pfam: tRNA-synt_2b HGTP_anticodon HypA zf-FPG_IleRS NRDD TackOD1 Zn-ribbon_8
Other DBs
NCBI-GeneID: 660646
NCBI-ProteinID: XP_971952
UniProt: D6WC57
Position
LG2
AA seq 448 aa
MVIRNLHRLSRLFQPVSVVPKNAEVKRHDITSKSQRLMLELGIIRQASPGCFHFLPLGVK
SLEKLTRLVDEEMKKIGGQKIIFPTLTNAKLWEKTGRLETVSSELFQIKDRHDQSYILSP
THEEAASNLLASLAPISYKHLPLKLYQITSKYRDEMKPRFGLMRGKQFLMKDMYSFDTDL
ETAKHTYDEICKSYDRIFRRIGIDFVKVVGCSGHMGGELSHEYHYKADVGEDKILTCNKC
NYSANTEVSGEEKCPNCGNTSVKIHLGIEVGHTFLLGEKYSKPLNATFLNNHGKPDVLQM
GSYGLGLSRILAAVIEVMSSEQEIRWPQILSPYSVIILPPKSGSKEETHIKDSGLVDSLY
EKIETTCNLQDNVLIDDRTNFTIGRRFLEAKKNGYPFIVTLGKKIVENPLLYEITNLKTN
ETLFLSENDLMNYLRSQLSSFSSDSDNK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atggttattcggaacttgcaccgactctcccgccttttccagccggtttcggtggtcccc
aaaaatgcggaagtcaagcggcacgatatcacttcgaagagtcaacgattaatgctagag
cttgggattataagacaagcgagtccgggttgtttccattttttgccattaggggtcaag
tctttggagaaactaacaaggcttgttgatgaggaaatgaaaaaaattggggggcaaaaa
attatttttcccacgttaactaacgcgaaactgtgggaaaaaacaggcagattggagact
gtttccagtgagcttttccaaattaaagaccggcatgaccagagttatattttaagccct
acacatgaggaggccgcgagtaatttacttgcgtcgttggcgccgatttcgtacaagcac
ttacctttaaaactgtatcagattacaagtaaatatagggacgagatgaaacccagattt
gggttaatgaggggaaagcagtttcttatgaaagacatgtattcgtttgataccgacctc
gaaacggccaaacacacttacgatgaaatttgtaaaagttacgatcggatttttaggaga
attgggattgattttgtcaaagtggtgggttgttcgggacatatggggggcgaattatcg
cacgaataccactacaaagcggacgtaggcgaagataaaattttaacgtgcaacaaatgc
aactattcggcaaataccgaagtttcaggggaggaaaaatgccccaattgtgggaacact
tcagtcaaaattcacttagggatagaagttggtcacacttttcttttgggcgaaaaatac
tcaaaaccgcttaatgccacttttttgaataatcacggcaaaccggacgtgttacaaatg
ggcagttatggactggggttatcacggattttagctgccgtaattgaagtcatgtcaagt
gaacaagaaatcaggtggccccagattttatcaccttacagcgtcattattttgcctccg
aaaagcggaagtaaggaagaaacacacattaaggattcgggtctagttgactcactttac
gaaaaaattgaaacgacttgcaatttacaagacaatgttttaatcgacgacaggacgaat
tttacgatcggtcgccggtttctagaagcaaagaaaaacggatatccttttatcgtaact
ttaggtaaaaaaatcgtagaaaacccacttttatacgaaattactaatttaaaaacgaat
gaaacgctatttctaagtgagaatgatttaatgaattatcttaggagtcagttatcgtcg
ttttcgagcgactctgataataaataa

DBGET integrated database retrieval system