KEGG   Tribolium castaneum (red flour beetle): 660728
Entry
660728            CDS       T01046                                 
Name
(RefSeq) alpha-mannosidase 2
  KO
K01231  alpha-mannosidase II [EC:3.2.1.114]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00510  N-Glycan biosynthesis
tca00513  Various types of N-glycan biosynthesis
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    660728
   00513 Various types of N-glycan biosynthesis
    660728
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.114  mannosyl-oligosaccharide 1,3-1,6-alpha-mannosidase
     660728
SSDB
Motif
Pfam: Glyco_hydro_38N Glyco_hydro_38C Alpha-mann_mid Glyc_hyd_38C_2
Other DBs
NCBI-GeneID: 660728
NCBI-ProteinID: XP_015836826
UniProt: D6WTA9
Position
LG7:complement(3287120..3292499)
AA seq 1133 aa
MMRLKRAVALIGAALIVLIIIEIYSTRDFSEFVGKKLPVVSDDSEKWSHLEDRLKQLEHD
LNRHGNEVQDIKNVIKNIIPLNTSASTVRKTPHRGGVKPVITEFLFESNCPFQLSFIPKT
DIQMLEVYHRLKFDNPDGGVWKQGWKIEVDEKDWNRQNKLKVFVVPHSHNDPGWVKTVED
YYLTQTKHILNNMLLKLPEDPRRKFIWAEISYFSMWWDDLREDEREVVKKLLRNNQLEIV
TGGWVMNDEANAHWIAVMQQLTEGHQWLQQNLNYTPISSWSIDPFGMSSTQPVLLKEMGF
RNMLMQRVHYSIKKEFASRQQLEFRWRQLWDGSGKTDIFTHMMPFYSYDVPHTCGPDPKI
CCQFDFKRLPGHGLHCPWKVPPQEITEKNVAYRAELLLDQYRKKSKLYKTNVVLAPLGDD
FRYDHSTEWDVQFRNYQKLFDYMNANLNLNVQAQFGTLSDYFDAVHKERKDNDFPSLSGD
FFTYADRDDHYWSGYYTSRPFYKRMDRILLANIRAAEIILTLAYLSGKPGSAWIGDREVG
LEKQLSDARKSLSLFQHHDAITGTSKDHVVVDFGKKMLAALNNCHHVIQHSAHILFSGKD
AETPDHSALFYNIDDVRHSHDTIGEKYQITIGPELRTKRIAIFNSLTFSRVEVVTFHVST
PYVEVLDAKKRRVKCQISPIFEYGASMSQTKYQLSFVANVPAFGLVSYTIGALWEYESPA
ETVRSSIRIYNQFGEVQAPIVFTDIEVSPSTREFTLQNNRLTASFNALGLLKALKVGGNT
VPVHLDFAKYGVRQSEERSGGYLFLPDGDAIPIQIENTIVNVIQGPIVSAVTVQLPYVRH
TVTLYSSTGADSLGIEIENIVDISKTSNFELVMRLSTNIQSSDQFYTDLNGFEVIRRKRF
HKLPLQANYYPIPSMAYIEDATTRLTLLTGSPLGTTSLRQGQIEVMLDRRLNQDDNLGMG
QPVLDNHPTKHVFRVLLEQKGASCRATTEGHPAGFPTLSSYVSSQSLLNPLVRLLRTEDE
DTQSQPNYLSVESEFGVDFMVPTLRTGVTLKGQDHVGFVLHRQFVDVCFADSTLLKQFPL
SQGSVNISALLPTETGSKLHKTSLSFLLMKNEVNIRGDFVMCPMEIQAFVLQR
NT seq 3402 nt   +upstreamnt  +downstreamnt
atgatgcgactaaaaagggctgtggccctgattggcgcagcccttattgtacttataata
atcgagatttactcaacgagggatttttccgaatttgttggtaaaaaactgccggttgtg
agcgacgatagcgagaaatggtcacacctggaagaccgcctaaaacagctggaacacgac
ttgaaccggcacgggaacgaagtccaagatataaagaacgtaattaagaacataattcca
ctaaacacgagcgcaagcactgtcagaaaaaccccacacaggggcggcgttaaaccggtt
ataaccgagttcttgttcgaatcaaattgcccgttccagttgagttttatcccaaaaacc
gacattcaaatgttggaggtttaccaccgactgaaatttgataatccagacggcggggtc
tggaagcagggctggaaaatcgaagtcgatgagaaagactggaaccgccagaacaaactc
aaagttttcgtcgttccgcattcgcataacgaccccggttgggtgaagacagtcgaggat
tattacctcactcagaccaagcatattttaaataatatgctactaaaactgccggaagac
ccgcgccggaagtttatctgggcggagatttcgtatttttcaatgtggtgggacgattta
cgggaggacgaacgcgaagttgtgaaaaaattgctcagaaataatcaattggagattgtg
actgggggttgggtgatgaatgacgaagctaacgcacactggattgcggtgatgcaacag
ttgactgaggggcatcagtggttgcagcaaaatttgaattacacgccgattagtagctgg
tccattgacccgttcgggatgtcttcaactcagccggttttgttgaaggagatgggtttt
aggaatatgctgatgcagagggtgcactactcgattaagaaggagtttgcgagtaggcag
cagttggagttcaggtggagacagctgtgggacggttcgggcaaaaccgacattttcact
cacatgatgcccttctacagctacgacgtgcctcacacttgcggtcccgacccgaaaatt
tgttgtcagttcgattttaaaagacttccaggacacggacttcactgtccatggaaagtg
cccccacaggaaatcaccgaaaagaacgtagcctacagagccgagcttttgctcgaccaa
taccgcaaaaaatcaaaactgtataaaacaaacgtagttctggcacctctcggtgacgat
ttccgctacgatcactcgaccgaatgggacgtccagttccgaaactaccagaaattgttc
gattacatgaatgccaacctaaatttaaacgtccaagcacagtttggcacacttagcgat
tatttcgatgctgtgcataaagagcggaaagataacgattttccctcgttatcgggcgat
tttttcacttatgcggacagggacgatcactactggagcggttattacacctcaaggccg
ttttataaacgcatggaccggattttactcgctaatatcagagccgctgaaataatccta
actttggcatacttgagtggcaagcctggctcggcctggatcggcgatcgcgaagtaggc
ttggaaaaacaattatcagacgccagaaaatcgctttcattgtttcaacatcatgacgct
attacaggaacctctaaagatcacgtggtggtcgattttggcaaaaagatgttggcagct
ttgaataactgccaccacgtgatccaacactcggctcatatcttattttcggggaaagac
gcggaaacgcccgatcacagcgccctcttttacaatatcgatgacgtcaggcattcgcat
gacacaattggggagaagtatcaaatcaccattgggcccgaattgaggactaaacgaatc
gctatttttaattcgttgacgtttagtcgcgtcgaagttgtgacgtttcatgtctcaacg
ccgtatgttgaagttttagatgcgaaaaaacggcgtgttaaatgccaaatttccccgatt
tttgaatatggcgcctcaatgtcgcagaccaagtaccaactgtcgttcgttgccaatgtt
ccagcgttcggattggtcagttacacgattggtgcgttatgggaatacgaatcgccagcc
gaaaccgtccgaagttcgattcggatttacaatcaattcggggaagtacaggcgccgatt
gtttttaccgatattgaagtatcgccaagtacgagagaatttacgttgcaaaacaatcga
ctaactgcgagttttaacgcactgggattgctcaaagcgttgaaagttgggggaaataca
gttcccgttcatttggattttgccaaatatggggtaagacaaagcgaagaaaggagtggg
gggtatttgtttttgccagatggtgatgcgattcccatacaaattgaaaatacgatagtt
aatgtgattcaaggaccgatcgtgtcggcggttacggtacagttgccctacgtgaggcat
actgtgacgttgtatagctcgacaggcgccgacagtctcggaatcgagatcgaaaacatc
gtcgatatttcaaaaacctcaaacttcgaactggtgatgcgtctgtcgaccaatatccaa
agttctgaccagttctacaccgatttgaacggctttgaggtaatcagaagaaaacgcttc
cacaagcttcctcttcaagccaattattatccgatcccgtcaatggcttacattgaagac
gcgactacaagactcacacttttgaccggaagcccccttggaactacttctctaaggcaa
ggccaaatcgaagtaatgctcgaccggagattaaaccaagacgataatttggggatggga
caaccggtcttggacaaccaccccacaaaacatgtctttagggtgctcttggagcaaaaa
ggggcctcgtgtcgagccacaacggaaggacatccggcaggatttccaactttatcatcg
tatgtctcttcacagagtttgttaaaccccttagtgagattattgcgcaccgaggacgag
gatacacagtcccaaccgaattacttaagtgttgagtcggagtttggggttgattttatg
gtaccaaccctgcggacgggagtgactctaaaggggcaagaccacgtcggttttgtgctt
catcggcaatttgtcgatgtctgttttgccgactccacgctgctcaagcaatttcccttg
agtcaaggatcggtcaatattagcgcacttttgcccactgaaaccggcagcaagttacac
aaaacgtcgttatcatttctattgatgaaaaacgaggttaatatccgaggtgactttgtc
atgtgtcctatggaaattcaagcgtttgttttacaaaggtga

DBGET integrated database retrieval system