KEGG   Tribolium castaneum (red flour beetle): 660758
Entry
660758            CDS       T01046                                 

Name
(RefSeq) NADH-cytochrome b5 reductase 2
  KO
K00326  cytochrome-b5 reductase [EC:1.6.2.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00520  Amino sugar and nucleotide sugar metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    660758
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.2  cytochrome-b5 reductase
     660758
SSDB
Motif
Pfam: FAD_binding_6 NAD_binding_1 NAD_binding_6
Other DBs
NCBI-GeneID: 660758
NCBI-ProteinID: XP_008201302
Position
LG2:5720450..5726803
AA seq 321 aa
MLDNKINILNRVPQNHRQLVLPIALGVGVIITSVLIYHFYKTSKPSKSKGKKKILLEDPQ
AKYSLPLIEKEEISHDTRRFRFGLPTKEHVLGLPIGQHIHLSAKIGDDLIIRSYTPVSSD
DDHGFVDLVVKVYFKKVHPRFPDGGKMTQHLESLKIGDTIEVRGPSGRLQYQGHGTFSIK
KLRKDPPQIVTVNKVSMIAGGTGITPMLQLIRHITKDPSDKTKLKLIFANQTEKDILVRK
ELEEVAKEHPDQFELWYTLDTPPENWKYSSGFINENMIKDHLFPPSNDNIVLMCGPPPMI
NYACNPSLEKLKYDKDLCFAY
NT seq 966 nt   +upstreamnt  +downstreamnt
atgcttgacaataaaatcaatattttgaaccgagtccctcaaaaccaccgccaattggtt
ctaccaatagccctaggggtcggcgtcatcatcacaagtgtattaatttatcacttctac
aaaacatcaaaaccatcaaaatcaaaaggcaaaaagaagattttacttgaggaccctcaa
gcgaaatattcgcttcctttgattgaaaaggaagaaatcagtcatgatacccgcagattt
aggtttgggttgcccacaaaagagcacgttttggggcttcccattggtcaacatattcat
ttgtctgcaaaaatcggtgatgacttaataatccggtcatacacccccgtatcttcagac
gatgaccatggatttgttgacttagtggtcaaggtgtacttcaaaaaagtccacccccga
tttcccgatgggggcaaaatgacgcaacacctcgaaagtttgaaaatcggtgataccatc
gaagttagaggaccatctggacggttacagtaccaaggacatgggaccttttccattaaa
aaactacgcaaagacccaccacaaatcgttacagttaacaaagtttctatgattgcgggt
ggtactggcattacacccatgctacaacttatcagacacatcacaaaagacccaagtgat
aagacaaaactaaaactgatttttgcaaatcagactgagaaagacattttggttcgaaag
gaactggaggaagtggcgaaggagcatccagatcagtttgaactgtggtacactctcgat
acacctccagaaaattggaaatacagttcaggctttatcaatgaaaatatgatcaaggac
catctcttccccccaagcaatgataacattgtactcatgtgtggacccccacctatgatt
aattacgcctgtaatcccagtttggagaagttgaaatatgataaagatctgtgcttcgct
tattaa

DBGET integrated database retrieval system