KEGG   Tribolium castaneum (red flour beetle): 660841Help
Entry
660841            CDS       T01046                                 

Definition
(RefSeq) L-xylulose reductase
  KO
K03331  L-xylulose reductase [EC:1.1.1.10]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00040  Pentose and glucuronate interconversions
tca01100  Metabolic pathways
Module
tca_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    660841
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.10  L-xylulose reductase
     660841
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_10 THF_DHG_CYH_C RmlD_sub_bind Polysacc_synt_2 ApbA 3Beta_HSD AceK
Motif
Other DBs
NCBI-GeneID: 660841
NCBI-ProteinID: XP_972137
Position
LG8
AA seq 244 aa AA seqDB search
MEISFHGKRALVTGASQGIGRDIALQLAKCGAKVIAVARNKELLDELKNENPSIDTLSVD
LSDWKATQNTLSNIFPIDLLVNNAGIVILKPVPTFDESDVDRIFDINVKALINVTQMVTR
DLLSRKSPGSIVNISSQTAKVGLERHSVYCGTKGAVDAYTRAVALELGPYNIRVNCVNPT
VIMTEMGKKGYADPKLAEPLKQKIPLRRFGEVREVTDAVLFLLSDKATMITGESLLVDGG
YVQA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
atggaaattagtttccacggaaaaagagcccttgtcacaggagccagccaaggaattggc
cgtgatatcgccctccaattggccaaatgtggagccaaagtgatagcagtggcccgaaat
aaagaactgttggatgagttaaaaaacgagaacccgtccattgacacactttccgtcgat
ttatccgactggaaagccactcaaaacacactatccaacattttcccaattgaccttcta
gtcaacaatgccggaattgtgattttgaagcccgttccgacctttgacgagtcagacgtc
gaccgtattttcgacatcaacgtcaaggctctcataaatgtgactcaaatggtcactaga
gacctcctctccaggaaatcccccggttccattgtcaacatatcgtctcaaacggccaaa
gtcggccttgaaagacactcagtctactgtgggaccaagggcgccgtcgacgcctacaca
agggccgtagccctggaacttggcccttacaacatccgggttaattgtgttaaccccact
gttatcatgaccgaaatgggcaaaaagggctatgcggacccgaaactagccgaacccttg
aaacagaaaatccccttgaggcggttcggggaagtccgggaagtaaccgacgctgttttg
tttctattaagtgacaaggcgactatgattaccggcgagtcgcttctagtagatggagga
tatgtacaagcttag

DBGET integrated database retrieval system