KEGG   Tribolium castaneum (red flour beetle): 661039
Entry
661039            CDS       T01046                                 
Name
(RefSeq) mitochondrial inner membrane protease subunit 2
  KO
K09648  mitochondrial inner membrane protease subunit 2 [EC:3.4.21.-]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03060  Protein export
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03060 Protein export
    661039
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    661039
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:tca03029]
    661039
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.21  Serine endopeptidases
    3.4.21.-
     661039
Peptidases and inhibitors [BR:tca01002]
 Serine peptidases
  Family S26: signal peptidase I family
   661039
Mitochondrial biogenesis [BR:tca03029]
 Mitochondrial protein import machinery
  Inner mambrane
   Other inner membrane factors
    661039
SSDB
Motif
Pfam: Peptidase_S26
Other DBs
NCBI-GeneID: 661039
NCBI-ProteinID: XP_972321
UniProt: D6WFF2
Position
LG3:complement(2104583..2105389)
AA seq 168 aa
MKITTLIKNIIIGVPIGVTILDTVGYVARVDGISMQPALNPHQSTTDYVFLNRWSVKSYD
IKRGDIISLISPKDPTQKIIKRVVGIQGDVVATLSYKSTVVRIPEGHCWVEGDHTGHSMD
SNNFGPVSLGLVTAKASCIVWPPSRWQFIQSFLPASRVPLNLSSKSLL
NT seq 507 nt   +upstreamnt  +downstreamnt
atgaaaataaccacccttatcaaaaatataattatcggagtgcccatcggtgttacaatc
cttgatactgtcggttatgtagctcgtgtggatggaatttccatgcaaccagctctgaac
cctcaccaaagcacaacagattatgtttttctgaacaggtggtctgtgaaatcgtacgac
ataaaaaggggggacataatatcgcttatctctcccaaagatccgacacagaagatcata
aagcgagtagtgggaattcaaggtgatgtagtggccactcttagttacaaatcaacagtt
gttcgaattcctgaaggacactgttgggtggaaggtgaccatactggtcattccatggac
tcgaataactttggtccggtctctcttggcttagttacagcaaaagcttcgtgtattgta
tggccaccgtcaaggtggcaatttatacagtccttcttgcctgcctcccgtgtacccctg
aacctctcttccaagtcgttgttatag

DBGET integrated database retrieval system