KEGG   Tribolium castaneum (red flour beetle): 661059
Entry
661059            CDS       T01046                                 

Name
(RefSeq) dolichyl-diphosphooligosaccharide--protein glycosyltransferase subunit STT3B
  KO
K07151  dolichyl-diphosphooligosaccharide---protein glycosyltransferase [EC:2.4.99.18]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00510  N-Glycan biosynthesis
tca00513  Various types of N-glycan biosynthesis
tca01100  Metabolic pathways
tca04141  Protein processing in endoplasmic reticulum
Module
tca_M00072  N-glycosylation by oligosaccharyltransferase
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    661059
   00513 Various types of N-glycan biosynthesis
    661059
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    661059
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:tca01003]
    661059
Enzymes [BR:tca01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.99  Transferring other glycosyl groups
    2.4.99.18  dolichyl-diphosphooligosaccharide---protein glycotransferase
     661059
Glycosyltransferases [BR:tca01003]
 N-Glycan biosynthesis
  N-linked oligosaccharide
   661059
SSDB
Motif
Pfam: STT3
Other DBs
NCBI-GeneID: 661059
NCBI-ProteinID: XP_972341
UniProt: D6WTB5
Position
LG7:complement(3337624..3341635)
AA seq 776 aa
MAQAGSKKSQLTKINSKTGINSLIIFVVLLLAWIAGFSSRLFAVIRFESIIHEFDPWFNY
RATAYMVKHGFYNFLNWFDERAWYPLGRIVGGTVYPGLMITSGSIHYVLHLLNINVHIRD
ICVFLAPIFSGLTAISTYFLTKELWSAGAGLFAACFIAIVPGYISRSVAGSYDNEGIAIF
ALQFTYFLWIKSVKTGSVFWAVAAALSYFYMVSAWGGYVFIINLIPLHVFVLLLMGRFSN
RLFTSYTTFYILGLICSMQIPFVGFQPIRTSEHMAASGVFALLFAVATLKYLQTMLSKSE
FKSLVIFGGLISAGVVFLTVVGLTYAGYIAPWSGRFYSLWDTGYAKIHIPIIASVSEHQP
TTWFSFFFDLHILVATFPAGLWYCIKNVNDERVFVILYALSAVYFAGVMVRLMLTLTPVV
CILSGIAFSGLLELFLREDDTPRNEDSDDDEQSPPNNRRLYDKAVAGRVPKMKHEQNKES
DGIGPNIRSIVTVVIMLLLMLFAVHCTWVTSNAYSSPSIVLASYGSDGSRQILDDFREAY
FWLSQNTADEARVMSWWDYGYQIAGMANRTTLVDNNTWNNSHIALVGKAMSSNESAAYEI
MTALDVDYVLVIFGGVIGYSGDDINKFLWMVRIAEGEHPKDIRESDYFTEHGEFRVDAEG
APTLLNSLMYKLSYYRFGELKLDYRTPAGYDRTRNAIIGNKDFQLTYLEEAYTTEHWLVR
VYRVKKPDEFNRPRIPVANRVVKSQNFVSKKSTKRKKGTIKNKPVIVKGKRLSKQA
NT seq 2331 nt   +upstreamnt  +downstreamnt
atggctcaagccggttcgaaaaagtcccaattaaccaaaataaatagtaaaaccggaata
aacagtcttataattttcgtcgttctcctcctggcatggatcgccggcttttcgtcccgt
ctcttcgccgtgatccgtttcgaaagcataattcacgaatttgatccatggttcaattac
cgcgccacggcgtacatggtcaaacacggcttttacaattttttgaactggtttgatgag
cgcgcctggtaccccttggggcgcatcgtggggggcacggtgtaccccggattgatgatc
acgtcagggagcatacactacgtgttgcatttattgaacatcaatgtacatattagggat
atttgtgtgttcctggcccccatcttcagcggcctcacggccatctcgacctactttctg
accaaggagctgtggtcggcgggggccggccttttcgcggcgtgttttattgccattgtg
cctggatacatcagtcgttctgttgccggaagttacgataatgaaggtatcgcaattttc
gcacttcaattcacttatttcctctggattaagtcggtgaagacggggtcggtgttttgg
gccgtcgcagcggcactttcgtacttttatatggtctccgcatggggaggctacgtgttc
atcatcaatctaatcccgcttcatgtgtttgtcctccttctgatgggacgattttcgaac
cgattatttaccagttacaccactttctacatacttgggttgatttgctccatgcagata
ccatttgttgggttccaacccattcgtaccagcgaacacatggcggcttctggtgttttt
gcattacttttcgccgttgcgacgctaaaatacctacaaacgatgctctcaaagtctgag
tttaagtcgttggtgatttttggtggtttaatatcggcaggtgttgtttttctaacagtg
gtaggactgacctatgctgggtatattgcaccatggagtggccggttttattcattgtgg
gatactggatatgctaaaattcatattccaataattgcgtcggtttctgaacatcaaccg
accacttggttctcgtttttctttgatttgcatattttagttgcaacttttcccgctggt
ctgtggtactgtatcaaaaatgtgaacgacgagagggttttcgtgattctgtacgccctg
agtgcggtttatttcgccggcgttatggtccgtctcatgttaaccctaacacctgtggtg
tgcattttgagcggaatagcattttccggtcttttggagctatttttacgcgaagatgac
actccacgtaacgaagatagtgacgatgatgaacaatcacctccaaataatcgtcgatta
tatgacaaggccgttgccggccgtgtgccaaaaatgaaacacgagcagaacaaagaatcg
gacggaatcggtccaaatatacgtagcattgttaccgttgtcataatgttattgttgatg
ttgtttgcggtacattgtacttgggtcactagcaatgcttattcaagcccaagtatcgtc
ctagcatcatacggaagtgacggttcccgtcagattttggacgattttcgcgaagcttac
ttttggttgtcgcaaaatacagccgacgaagcgagagtgatgagttggtgggattacggg
tatcagatcgcaggaatggccaatcggacgacgttagttgacaataacacgtggaacaac
agtcacatcgccctggtggggaaggcaatgtcgtccaatgagagcgcagcttacgagatc
atgaccgcccttgatgtggactacgtcctagtgatcttcggcggtgtgattggctattcg
ggcgatgatattaacaagtttttgtggatggtgcggatcgcagaaggcgaacatcccaaa
gatataagagagagtgattattttacggaacatggcgagtttagagtggatgctgaaggg
gcgccaactctgttaaattcactcatgtataagttgagttattatcgatttggtgaattg
aagttggattatcgtacaccggctgggtatgatagaaccaggaacgcaattattggtaat
aaagatttccaacttacctacctggaggaggcgtatacgactgagcattggctcgtgagg
gtatacagggtgaagaaaccagacgagtttaataggccgaggattcccgtggcgaatcgg
gtggtcaaaagccagaatttcgtatcgaaaaagagcaccaaacgcaaaaagggtacaatt
aaaaacaagccagtcatcgtgaagggcaaaagactgtcaaaacaggcgtaa

DBGET integrated database retrieval system