KEGG   Tribolium castaneum (red flour beetle): 661079
Entry
661079            CDS       T01046                                 
Name
(RefSeq) deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00030  Pentose phosphate pathway
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    661079
Enzymes [BR:tca01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     661079
SSDB
Motif
Pfam: DeoC Sin3_corepress
Other DBs
NCBI-GeneID: 661079
NCBI-ProteinID: XP_972358
BEETLEBASE: TC012896
UniProt: D7EJ08
Position
LG3:complement(18883913..18887840)
AA seq 324 aa
MLERNPGCELDLGWLNSVNINLNAVNTAVEDILNSRDLKNDYRTAWLLKAVTCIDLTTLG
GDDTPSNVSRLCYKAAKPLPEDLLNQLGFDYRPDCPIRTAAVCVYPSRVEDAVKTLKKLK
LNDKINVASVATGFPSGQMPLKTRVEEIKYAVEKGATEIDIVIDRSLVLTGQWEVLYQEI
QQMKEACGSTAHMKTILATGELATLNNVYKASLVAMMAGSDFIKTSTGKESINATLPFGL
VMSRAIREYYEKFNYKVGLKPAGGIRTGRDAISWLIMVKEVLGNDWLTNKLFRFGASGLL
SDIEHNLYGNITKSYPAPYEFTMG
NT seq 975 nt   +upstreamnt  +downstreamnt
atgttagaaagaaacccaggttgcgaattagatttgggatggctaaacagtgtgaacata
aatctaaacgctgtaaatacagctgttgaagatattctgaattcccgagacctgaaaaac
gattacagaacagcttggttgctcaaagctgtgacttgcatcgacttgaccacactaggg
ggcgatgacacaccgagtaatgtctcacgattgtgttacaaagccgccaaacctttacct
gaagacttactaaaccagttaggttttgattatagacctgattgtccgattagaacggca
gcagtctgtgtttatccttccagagtcgaagatgctgttaaaactttgaaaaagttaaaa
ctcaatgataaaattaatgtggcttctgttgcaaccggttttcccagcggccaaatgcca
ctaaagacaagagttgaggaaatcaaatacgctgtagaaaaaggggccactgagattgat
attgtgattgatagaagtttagttttgactggtcaatgggaggttttatatcaggaaatc
cagcagatgaaggaagcttgtggttccactgcacacatgaagactattttggccactggt
gaattggcaacgctgaataatgtctataaggcgtcactggttgctatgatggcaggttct
gattttatcaaaacctccactggaaaggaaagtattaatgctactttaccttttggtctt
gttatgagtagagccattcgggaatactacgaaaaatttaattacaaggttggtttaaaa
cctgcggggggaattaggacaggtagagacgcgatttcttggttgataatggtaaaagag
gtattaggaaatgattggcttacaaacaaattgtttcgttttggagcttctgggcttttg
tctgatattgagcacaacctttatggaaatattacaaaatcttatcccgccccttatgaa
tttacaatgggatga

DBGET integrated database retrieval system