KEGG   Tribolium castaneum (red flour beetle): 661080
Entry
661080            CDS       T01046                                 

Name
(RefSeq) uncharacterized LOC661080
  KO
K03213  naked cuticle
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    661080
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tca04990]
    661080
Domain-containing proteins not elsewhere classified [BR:tca04990]
 EF-hand domain-containing proteins
  Other EF-hand domain-containing proteins
   661080
SSDB
Motif
Pfam: EF-hand_6 EF-hand_7
Other DBs
NCBI-GeneID: 661080
NCBI-ProteinID: XP_008200263
Position
LGX:complement(1194613..1202183)
AA seq 576 aa
MDIWLLMHNSQMANNLVKWWKTKFLNGYKQFSVECGDGKVSDTEELLGRLGSEVDGNERL
RSTTPPLPSQDETVPTPTPDDASNTPKKQPQHHLNFEEFSCDVSVEGGEKSKSGQERQEF
SFTLYDFDGYGKITKDDIAGLVTTIYEALGSSVKVPHYGSKTIKVKLTVSPDQRKHVSAT
IINQKDNNEEKTQETSIRYKRDLNVTIRQGINEKRKHGRRQSKPKTPNKKHQCCNKHEEE
DQENPFVSDDSSDACSRISGNLTSDEEEGECSDNERHKPKKHQKKCHRSTSPRYTIPNLF
IKDANICNENNCSKKTPKKRSGSLQRQELLEIIQANMDKNNLGFQTPRKHSNHVSTQTRQ
LEGPHKSQSKSPKVSPSPLQYLANIVDPTHFYVDLASLQNTTQLPQTHCQYDKLIDAVMC
VSNKKISLNKQKCRKHRVRNDLADIRYQFLQYPMTNDENKLNKPNKRTPKKSVSDVKKSP
HVVTGHTSSPHHLRHKNRQEDQARAMAQVVRWLEQEFSSNLNTKEKAKGNHFHSTKEKTT
SAPSSPGSGVERHEHHHVHEHIHHHYHHYQETPLVV
NT seq 1731 nt   +upstreamnt  +downstreamnt
atggacatctggttgttgatgcacaattcacagatggctaacaatttagtgaagtggtgg
aaaacgaagtttctcaacggatataaacaattctcagtcgagtgtggcgatggtaaggtg
tccgatacggaagaacttctaggccgattagggtcagaagttgacggtaatgaaaggttg
agatcaacaacaccacctttgccatcgcaagacgaaaccgttcctacgccaacacccgac
gatgcctcaaacacgccgaaaaagcagcctcaacaccatctcaattttgaggaattttcc
tgtgacgtgtcggtggaaggcggggaaaagtcaaagtcggggcaggagcgacaggaattt
tctttcacgctgtatgactttgatggatacgggaaaataactaaggatgacattgccggt
ttagtaacgacaatttacgaagctttaggatcgtcagttaaagtgccccattacggcagc
aaaacaattaaggttaaacttaccgtatcacccgaccagcgtaagcacgtaagtgctaca
atcatcaaccaaaaagacaataacgaggaaaaaacgcaagaaactagtatacgatataaa
agagacttaaacgtgaccataagacaaggtattaacgaaaaacggaaacacggtagaaga
caatcgaaaccaaaaacaccaaataaaaagcaccagtgttgtaacaaacacgaggaagaa
gaccaagaaaatcccttcgtatcggatgacagctcggatgcttgcagtcgaatatccgga
aacttaaccagcgacgaagaggaaggagagtgttcggataatgaacgacataaaccaaaa
aagcatcaaaagaaatgtcacagaagcaccagccctagatatactataccaaatttattt
ataaaagacgcaaatatctgcaacgaaaataactgctcaaagaaaacgccgaagaagagg
tcgggctccttgcagcgccaggagctgctcgaaatcatacaggccaacatggacaagaat
aacctaggttttcaaacgccgagaaaacattccaaccatgttagcacgcagacgcgtcag
ctggagggcccccacaagtctcagtcgaagagccccaaggtgtccccgtcccccctgcag
tacctggcgaacatcgtggacccgacgcacttctacgtggacttggcgtcccttcagaac
acaacccaactcccccaaacccactgccagtacgacaagctgatcgacgccgtgatgtgc
gtgtcgaataaaaaaatctcgttaaacaaacaaaagtgtcgaaagcaccgcgttaggaac
gacctcgccgatatccggtaccagtttctccaatatccgatgacaaacgacgagaacaaa
ctgaacaaaccgaacaaaagaacgccaaaaaagagtgttagtgatgtgaaaaagagcccc
catgtcgtgacggggcacacgtcctcgccgcaccacctgcgccacaagaaccgccaggag
gaccaggcccgcgccatggcgcaggtggtgcgctggctggagcaggagttctcgtcgaat
ttgaacacgaaggagaaggccaaaggcaaccacttccactccacgaaggagaagaccacc
agcgcgccctccagccccggctcgggggtcgagcgccacgagcaccaccacgtgcacgag
cacatacaccaccactaccaccactaccaggaaacgccgctggtggtatag

DBGET integrated database retrieval system