KEGG   Tribolium castaneum (red flour beetle): 661114
Entry
661114            CDS       T01046                                 

Name
(RefSeq) 26S protease regulatory subunit 7
  KO
K03061  26S proteasome regulatory subunit T1
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03050  Proteasome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    661114
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:tca03051]
    661114
Proteasome [BR:tca03051]
 Eukaryotic proteasome
  Regulatory particles
   PA700 (19S proteasome)
    ATPase subunits
     661114
SSDB
Motif
Pfam: AAA AAA_lid_3 AAA_22 AAA_5 AAA_16 DUF815 AAA_2 RuvB_N AAA_33 AAA_7 AAA_28 AAA_18 Prot_ATP_ID_OB Sigma54_activ_2 Mg_chelatase TIP49 AAA_14 RNA_helicase AAA_24 T2SSE IstB_IS21 Sigma54_activat
Other DBs
NCBI-GeneID: 661114
NCBI-ProteinID: XP_972389
UniProt: D6WX64
Position
LG8:10494266..10496357
AA seq 434 aa
MPDHLGDDMRKVKTDKEEPEKEIKSLDEGDIALLKTYGQGQYTKTIKTVEDDIQTIIKRV
NELTGIKESDTGLAPPALWDLAADKQTLQNEQPLQVARCTKIINADTDDPKYIINVKQFA
KFVVDLADSVAPTDIEEGMRVGVDRNKYQIHIPLPPKIDPTVTMMQVEEKPDVTYSDVGG
CKEQIEKLREVVETPLLHPEKFVKLGIEPPKGVLLFGPPGTGKTLCARAVANRTDACFIR
VIGSELVQKYVGEGARMVRELFEMARSKKACLIFFDEIDAIGGARFDDGAGGDNEVQRTM
LELINQLDGFDPRGNIKVLMATNRPDTLDPALMRPGRLDRKVEFGLPDLEGRSHIFKIHA
RSMSVERDIRFELLARLCPNSTGAEIRSVCTEAGMFAIRARRKVATEKDFLEAVNKVIKS
YAKFSATPRYMTYN
NT seq 1305 nt   +upstreamnt  +downstreamnt
atgccggaccatttgggtgacgatatgcgaaaagtaaaaaccgataaagaagagccggaa
aaggaaataaaatccctcgatgaaggagatatagccctgctgaagacctacggccagggt
caatacaccaagacaataaaaacggtggaagacgacatccaaacaattattaaacgtgtt
aatgagttaaccggtattaaagagtctgacacagggttggccccaccggccctgtgggac
ttggccgctgataagcaaaccctgcagaacgaacagcccttgcaggtggccaggtgcacc
aaaatcatcaacgcggacaccgacgaccccaaatatatcataaatgtgaagcaattcgcc
aagtttgtggtggatttggccgattcggtggcccccacggatatcgaggagggtatgaga
gtgggtgttgaccgcaataagtaccaaatccacatccccttgccccccaaaatcgacccc
actgtcactatgatgcaagtggaggaaaaacccgatgttacatacagtgacgttgggggt
tgtaaggagcaaattgagaaattgcgagaagtggttgaaacacctttgttacacccggaa
aaattcgtcaaattggggattgagcccccgaaaggggtccttcttttcggcccccctggc
accggtaaaactctttgtgcccgtgcagtggccaaccgtacagacgcctgctttatccgc
gtaattgggtccgaactggtccagaaatacgtaggcgagggggcccgaatggtccgcgag
ttgttcgaaatggcccgttcgaaaaaagcctgtttgatatttttcgacgaaattgacgcc
ataggcggcgctaggtttgacgacggcgccggtggcgacaacgaggtgcagcgcacgatg
ttggaactaatcaaccaactggacggtttcgaccccagggggaatattaaggttctgatg
gcgacaaacaggcccgatacgctggatccggccctgatgaggccaggccgacttgaccgc
aaggtcgagttcgggttgccggacctggagggccgcagccacatcttcaagatccatgcc
aggtcgatgagtgtggagagggacattaggttcgagctgttggctcgcctgtgtccgaac
tccacgggggcggagatcaggagcgtgtgcaccgaggcggggatgtttgccattagggcc
aggaggaaggtggccaccgagaaggacttccttgaggcggtgaacaaagtcatcaagtcg
tatgcgaagttttcggccactcccagatacatgacttataattaa

DBGET integrated database retrieval system