KEGG   Tribolium castaneum (red flour beetle): 661412Help
Entry
661412            CDS       T01046                                 

Definition
(RefSeq) venom acid phosphatase Acph-1
  KO
K19283  prostatic aicd phosphatase [EC:3.1.3.2 3.1.3.5]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    661412
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.2  acid phosphatase
     661412
    3.1.3.5  5'-nucleotidase
     661412
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 661412
NCBI-ProteinID: XP_972663
UniProt: D6WC82
Position
LG2
AA seq 372 aa AA seqDB search
MKLVLFLLAIFAVALPAKIPDFAPTSSDTLVLLHVLFRHGNRTPDKFSQFPTDPHINDTF
EPFGYSQLTTKGKKTEFGIGQYIRQTYGDFIPEQYGPGVAYAISTDFKRTKMSLELVLAG
LFPPLESDVFSPGLNWQPVPYEIDDGIDLIRVPAMYCTTYLQQYYRYILSKEAQEVLKNY
QGLYQQVSNFTGKDIALPEEIFDIYETLESEKDFGLELPAWTLDIFPEVLEKASSVYIEF
ATATTGLKRLSTGRLLKKIIDDSLAKRDGTLSEDRKIFLYSAHDYSVGVMLRALEVFYSH
VPPYGATIFFEIHNIDGTYGLKLFYQDYSQETPRLLTIPGCSSFCDLDKVVELMSENFPT
EADVCNYSGELL
NT seq 1119 nt NT seq  +upstreamnt  +downstreamnt
atgaagttggtattgtttctacttgcgatttttgcggtcgccttacctgcaaaaattcca
gactttgctcctacaagttcagacactttggttctcctacatgtgctattcagacatggg
aaccgaacgcctgataaattcagccagtttccaactgatccccacattaacgacactttt
gaaccatttggttacagtcaattgaccaccaaaggaaagaaaaccgagtttggaatcggg
caatacattcgacaaacatacggtgattttatccccgaacagtatggaccgggcgttgct
tacgcaatttccaccgactttaaaaggactaaaatgtcgcttgaattagtcctggcggga
ctgtttccgccacttgagtcggacgtcttctcccctggtttaaactggcagccagtgcct
tacgaaattgacgacggaattgacctaatacgagttcccgccatgtactgtacgacctac
ctccagcagtattacagatacattttgtcaaaagaagcccaagaagtgttgaaaaattat
caaggtctttaccagcaagtatcaaatttcacgggaaaagatattgccttacctgaagaa
attttcgatatttacgaaacactcgaaagtgaaaaagattttggactcgagctgcctgca
tggactttggatatttttccagaagttttggaaaaggcgtcttcagtttatatcgaattt
gccaccgcgacaactggcttaaaacgattgtccacagggcgtttacttaaaaaaataatt
gacgacagtttggccaaacgagatgggactttatcagaagatcgcaagattttcttgtac
tcggcacatgattacagtgttggagtaatgttaagagccttggaggtgttctactcacac
gtaccaccctatggagctacgattttcttcgaaattcacaacattgatgggacttatggc
ttaaagctattctaccaggattatagccaggaaacacccagactgcttactatacctggc
tgttcaagtttttgcgatcttgacaaagtggtagagctgatgtctgagaattttccgact
gaagccgacgtctgcaattactcgggagagcttctgtaa

DBGET integrated database retrieval system