KEGG   Tribolium castaneum (red flour beetle): 661492
Entry
661492            CDS       T01046                                 

Definition
(RefSeq) mannosyl-oligosaccharide glucosidase
  KO
K01228  mannosyl-oligosaccharide glucosidase [EC:3.2.1.106]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00510  N-Glycan biosynthesis
tca01100  Metabolic pathways
tca04141  Protein processing in endoplasmic reticulum
Module
tca_M00073  N-glycan precursor trimming
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00510 N-Glycan biosynthesis
    661492
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    661492
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    661492
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.106  mannosyl-oligosaccharide glucosidase
     661492
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   661492
SSDB
Motif
Pfam: Glyco_hydro_63 Glyco_hydro_63N
Other DBs
NCBI-GeneID: 661492
NCBI-ProteinID: XP_972740
Position
LG10
AA seq 815 aa
MARQRRTQGAADPNKGTNSSSSNGSNSTNNRSSKSTSLLSYWKQIIGCIVLGIAVSLGYM
GYLETRVNTPFDDKKMVVKSGLQVPEQFWGTYRPGLYFGLKTRDPTSLVTGLMWYFPKRL
RPGGDGIRHWCEQGDGLEKYGWVKHDGSNFGVQEIIDGGYNIDTSFVKRLGGSHGGDWTA
RISVTKPGASEDVSLIWYTALDEETKGFISLTNSATKFTGIKGETTGLGEFTIKFTNNSG
VVSHESFLSTVAPGLHLLKETVVGSLRLAQDKPNSPRRIVLGGEILPETGTGKAQPNFVA
VQLTGKVPFSIDVVFESGSFGTRQDTLVGETYSKALAWHVARFGQRFEDTFGLHKKGYGP
KEVTFAQSALSNMLGGIGYFYGTSKVQSFYTKEPVHYWHAPLYTAVPSRSFFPRGFLWDE
GFHGFLIATWDLDLELDIISHWFDLMNVEGWIPREQILGVEAIAKIPEEFIVQRNTNANP
PTFFLTLQYILRKYYDKLSEGRLATLERLYPRLQAWFAWFNTTQKGAGPGMYRWRGRDAT
TNRELNPKTLTSGLDDYPRASHPTEAEYHVDLYCWIAIASDTLARLATLLDRDGYKYEQT
ADYLKDNFLLDNLHWSNYASRYADYGYHTDSVKLKRPKPLPRSQNQNMEMVRVTLKNPEY
RLVDSTFGYVSLFPFLLQMIDSDSLKLGQILDDLRNPDLLWTKFGLRSLSKNSPLYMKRN
TEHDPPYWRGQIWININFLAVRSLYFYANTEGPYRDKANAIYKDLRENVIKNVMTQYFKT
GYLWEQYNDETGEGSGCRPFTGWTALVVLLMGEQY
NT seq 2448 nt   +upstreamnt  +downstreamnt
atggcacgtcagagacggactcagggcgccgcagaccccaataaaggtacaaacagtagc
agcagcaatggtagcaactctaccaacaaccgatcttcaaaatccactagtctcctttca
tactggaagcaaatcatcggttgtattgttctgggaattgcggtgtctctgggctacatg
gggtacttggagacacgtgtcaatacccccttcgacgataagaagatggttgtcaaaagt
gggctacaagtcccggaacaattttgggggacgtacaggccggggctttatttcgggttg
aaaacacgtgaccccacgtcacttgtcaccggtttaatgtggtatttccccaaaaggttg
cgtccagggggtgatgggatacgtcattggtgtgaacaaggtgatgggttggaaaaatat
gggtgggttaaacatgatggtagtaattttggggtacaggaaattatcgatgggggctat
aatatcgatacgtcgtttgttaagcgacttgggggcagccatgggggcgattggacggct
cggatcagtgtcaccaaacctggggcaagtgaggatgtttcactcatctggtatacagcg
ttagatgaggaaacgaaaggttttatctcgcttactaattctgctacgaaatttaccgga
attaagggggaaactaccggtttaggggaattcactattaagtttacgaataattccggt
gttgtgagtcatgaatcgtttttgagtacggtagccccgggacttcacctactcaaggaa
acagtggtggggtcactaagactggcacaggacaaaccaaattcccccagacgtattgtt
ttgggcggggaaatactcccggaaacgggcaccggaaaagcacaaccaaacttcgtcgcc
gtacaattaacgggtaaagtcccgttttcgatcgatgtcgttttcgaatcgggtagtttc
ggtacaagacaggatacgctggtgggggagacttacagcaaggctttagcttggcacgtg
gccaggtttggacaaaggtttgaggatacctttggattacacaaaaaaggttatggtccg
aaagaggtgaccttcgcccaatcggccctcagtaacatgctgggaggcatcggctatttt
tacggcacttccaaagtgcaaagtttctacaccaaagaaccggtgcactattggcacgcc
cccttatacacagcagtcccgtctcgaagttttttccctcgtggttttctatgggacgaa
ggtttccatggctttctgatcgcaacgtgggaccttgaccttgaacttgacattatcagt
cattggttcgatttgatgaacgttgaagggtggatcccccgtgaacaaatcctgggtgtt
gaagctatagcgaaaatacccgaagaatttatcgtccaacgaaatactaacgcaaatccg
ccgactttcttcctcacgttgcaatacattttgcgtaaatattacgataagttgagcgag
ggacgtttggcaacactggaacggttgtatccaaggttacaggcgtggtttgcatggttt
aataccacgcaaaaaggggcggggcctggcatgtaccggtggagggggcgtgacgcaaca
accaatcgtgagctgaatccgaaaactttaacttcgggccttgacgattatccacgagcg
tcacatccgaccgaagccgaataccacgtcgatctatactgttggatcgccatagctagt
gatactttagcaaggttggcaacactgttggaccgtgatgggtataaatacgaacaaact
gccgattatttgaaagacaatttcctattggataatttacattggtctaattacgcatcg
cgttacgccgattatggttaccacactgattctgttaaattaaaacgaccgaaaccgtta
ccaaggtcacaaaaccaaaacatggagatggtgcgtgtgaccttgaaaaatcccgaatac
cgattggtcgactcgactttcggttacgtcagtttgtttccgtttttgttacaaatgatt
gattcggattcgttgaaattgggccagattttggatgaccttcgaaatcctgacttgtta
tggacgaagtttggtctaagatcactgtccaaaaattcacccctgtatatgaaacgcaac
accgaacatgatccgccatattggaggggccaaatttggataaatatcaattttctagca
gtccggtccttgtatttctacgccaatacggaggggccctatcgggataaagccaacgcg
atttataaagatttgcgggaaaatgtgattaaaaacgtgatgacgcaatatttcaaaacg
ggttatctgtgggaacagtataatgacgaaacgggggaggggagtggctgtaggcctttt
acgggctggacggccctggttgtattacttatgggcgagcaatactga

DBGET integrated database retrieval system