KEGG   Tribolium castaneum (red flour beetle): 661691Help
Entry
661691            CDS       T01046                                 

Definition
(RefSeq) multiple inositol polyphosphate phosphatase 1
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00010  Glycolysis / Gluconeogenesis
tca00562  Inositol phosphate metabolism
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    661691
   00562 Inositol phosphate metabolism
    661691
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     661691
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     661691
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 661691
NCBI-ProteinID: XP_008196167
Position
LG8
AA seq 709 aa AA seqDB search
MASVKILLLAPLFIVGLKAQYSSQPYDRNRTDNQYDPYNSQYDRQNPPYDRQNPPYDRQN
PPYDRQNPPYDRRNPPYGQPPYDRNDRYNSPPYDRNQPYNQSQYGRQNQSQYGPSYDNRD
PYNRDRLDNRDQYYVGNRDQYNRDRDQYGSNRDRDQYGGNRDQYGGNRDQYGGNRDQYGG
NRDQYGGNRDQYGGNRDQYGGNRDQYGGNRDQYGNRDQYGGNRDQYDRDRDRYDSDGDRD
RYGSPLFETNSDCCAEYCYAKDQNQYVQFATKTAYQIAFSKSTNQQHRVPDCTPIQFWSI
NRHGTRYPSARTIERLRQLYKIQREIVRNYQERNSYPNNGRLCPEDLDLIKGWRWNETVN
ERNANALTYQGVTDMKFLARRYASKFDELLREPYNEMTYSFQYTDTDRTHDSYQAYIEGL
FKEKAYQVHANVFNNDRLIKPTRSCNAWLREVDQNPQTFNEYMKFKHNREYQQMVRDVFR
RLGFRYTLNDTVLSDMYDMCRFEKAWNLDAMSPWCIVFNKEQLKLLEYAEDLKYYYKSGY
GNEVNRQIGCPPVKDLYEKFERTVNNGGTPTGNKVTVFFTHSVTIQTFLTAMGIAKDHQP
LTAENYYQQQHRKWRTSKIDPFASNLAAVLYQCRSGERYRVMFFLNEEPVNYPECSVGLC
NWSTVQNKLRGVVDNCNLDFCDRNAATAVQYNYIIYFSSLIAMFLSVKI
NT seq 2130 nt NT seq  +upstreamnt  +downstreamnt
atggcctcagtcaagatactcttgctggcgccacttttcatagttggtctcaaagctcag
tacagctcacaaccctacgatcgaaatcgtaccgacaatcagtacgatccttataactca
caatatgaccgtcaaaacccgccatacgatcgacaaaatccgccatacgaccgccaaaac
ccgccatacgaccgccaaaaccctccatatgaccgacgcaacccaccatatggacaacct
ccatatgaccgcaatgatcgctacaattcgcccccatatgaccggaaccagccatacaac
cagtcgcagtatggccgccaaaatcaaagccagtatggaccttcatacgacaatcgcgat
ccatacaatcgtgatcgtttggataaccgtgatcagtactatgtaggaaatcgtgatcag
tataatcgtgatcgtgatcaatacggaagtaatcgtgatcgcgatcagtatggaggaaat
cgtgatcagtatggagggaaccgtgatcaatatggaggaaaccgtgatcaatatggaggc
aatcgtgatcagtatggaggaaatcgcgatcagtatggaggcaatagggatcaatatggg
ggcaatcgggatcagtatggaggaaacagggatcagtatggaaatcgagaccagtatgga
ggaaatcgggatcagtatgaccgcgatcgtgatcgatatgatagtgatggtgatcgtgat
cgttacggttcgcccttgtttgaaacaaactctgattgttgtgcggaatattgctatgcg
aaagatcaaaatcaatatgttcagtttgcgaccaagacggcctatcagattgcgttttct
aagtcgacaaatcagcagcacagagtaccagactgtacaccaattcaattttggagcatc
aatagacacggtacgagatatcctagtgctagaaccatcgaacggttgagacaactgtat
aaaattcaacgcgaaattgtgcgcaactatcaggaaagaaattcgtatcccaacaacgga
cgactctgtcctgaagatttagatctcatcaaaggctggcgctggaatgaaactgtcaac
gaacgcaatgccaacgccttgacttaccagggagtaacagatatgaaatttttggcgcgc
cgttacgcttcaaagtttgacgagttgttgcgagaaccctataacgaaatgacctacagt
tttcaatatactgacactgatcggactcacgatagctaccaggcttacattgaagggctt
ttcaaggaaaaagcttatcaagttcatgctaatgtttttaataatgacagactgatcaag
cctacacgatcatgcaacgcctggctgagagaagtggaccaaaatccgcaaacattcaat
gaatacatgaaatttaaacacaaccgagagtatcagcaaatggtcagagacgtgttccga
agactaggtttcagatacacactgaatgacactgttttatccgatatgtacgacatgtgc
cgctttgaaaaagcttggaatttggatgctatgtctccttggtgcatagtttttaacaaa
gaacaactaaaacttctagaatacgccgaagatttgaaatactattacaaaagcggttac
ggcaatgaagttaaccgacaaattggttgtccacctgtgaaagatctttacgaaaaattc
gaacgtacagtcaataacgggggaacccccactggaaacaaggttacagttttcttcact
cattctgtgacgattcagacgtttttaacggcgatgggtattgcaaaggaccatcaacca
ttaactgcggaaaattactaccagcagcaacaccgcaagtggcgtacttcgaaaattgat
ccgtttgcgtcaaatttggctgcagttttatatcaatgccgtagcggagaacgttatcgc
gtcatgttcttcttgaacgaggaaccagtgaattatccagaatgttcagtcggtctttgc
aactggagtaccgtccaaaataaattgcgaggtgttgtagacaattgtaatttagatttc
tgcgatcgtaacgctgcaactgccgtccaatacaattacatcatttatttctcaagtctc
atcgccatgtttctaagtgttaaaatctaa

DBGET integrated database retrieval system