KEGG   Tribolium castaneum (red flour beetle): 661747Help
Entry
661747            CDS       T01046                                 

Definition
(RefSeq) eukaryotic translation initiation factor 3 subunit J
  KO
K03245  translation initiation factor 3 subunit J
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03013  RNA transport
Brite
KEGG Orthology (KO) [BR:tca00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    661747
Ribosome biogenesis [BR:tca03009]
 Eukaryotic Type
  Pre-40S particles
   Other pre-40S particles
    661747
Translation factors [BR:tca03012]
 Eukaryotic Type
  Initiation factors
   eIF-3
    661747
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: eIF3_subunit Glyco_hydro_47
Motif
Other DBs
NCBI-GeneID: 661747
NCBI-ProteinID: XP_966955
UniProt: D6WTE4
Position
LG7
AA seq 230 aa AA seqDB search
MESWDDDNFEPPSVTPVVASNKWEGEDEDDNVKESWEDEEEEKVEAAPAEEAKPKPKKQS
IADKIAEKERKRKEEMERRLREQQEEEISPEEKLRMQKESDLKIALETTFGGDTNSTNIS
GLDGLTLPTTKEEFQDFTDALSKKLQPLAKSTEYPVFTENLLRNLCATLSSLDIKKIKNT
LDNLYLEKQKIEKGEKSKKNKGKGKAKLRLDDGNPLSAYVNDYDDYDDFM
NT seq 693 nt NT seq  +upstreamnt  +downstreamnt
atggaatcgtgggacgacgataacttcgaacctccatctgttacacctgtggttgcgtcc
aacaaatgggaaggcgaggacgaagacgacaacgtcaaggaaagctgggaggatgaggag
gaggagaaggtggaagcggcgcctgccgaggaggccaaacccaagcccaagaagcagtca
atcgctgacaaaatcgcagagaaagaaagaaagaggaaggaagaaatggagcggaggctg
agggagcaacaggaggaggaaatctccccggaggagaagctcaggatgcagaaggaatcg
gacttgaaaatagcgctagaaacgacgtttgggggcgacaccaatagcacaaacatttca
ggtttagacggactcacgctgccaactactaaagaagagtttcaggactttacagacgct
ctctctaagaagctccaacctctagctaaaagcacagagtatccggtgttcaccgaaaac
ttactacgaaatctgtgtgccactttgtcctcattagatattaagaaaattaaaaatacg
ttagataatttatacctagagaaacaaaaaatcgagaaaggcgagaaatcgaagaaaaac
aaaggcaaaggcaaggctaaattacgactggatgatggaaatcctttgtcagcgtatgtt
aacgactatgacgattacgacgactttatgtag

DBGET integrated database retrieval system