KEGG   Tribolium castaneum (red flour beetle): 661810
Entry
661810            CDS       T01046                                 
Name
(RefSeq) hydroxyacyl-coenzyme A dehydrogenase, mitochondrial
  KO
K00022  3-hydroxyacyl-CoA dehydrogenase [EC:1.1.1.35]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00062  Fatty acid elongation
tca00071  Fatty acid degradation
tca00280  Valine, leucine and isoleucine degradation
tca00310  Lysine degradation
tca00380  Tryptophan metabolism
tca00650  Butanoate metabolism
tca01100  Metabolic pathways
tca01212  Fatty acid metabolism
Module
tca_M00032  Lysine degradation, lysine => saccharopine => acetoacetyl-CoA
tca_M00085  Fatty acid elongation in mitochondria
tca_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    661810
  09103 Lipid metabolism
   00062 Fatty acid elongation
    661810
   00071 Fatty acid degradation
    661810
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    661810
   00310 Lysine degradation
    661810
   00380 Tryptophan metabolism
    661810
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     661810
SSDB
Motif
Pfam: 3HCDH_N 3HCDH AlaDh_PNT_C NAD_binding_2 Pyr_redox NAD_Gly3P_dh_N Pyr_redox_2 F420_oxidored DAO UDPG_MGDP_dh_N Lipase_GDSL_3 TrkA_N NmrA Sacchrp_dh_NADP NAD_binding_7 NAD_binding_8 DUF3479 OCD_Mu_crystall OTCace GIDA HcgC DFP XdhC_C HI0933_like FAD_oxidored 2-Hacid_dh_C AdoHcyase_NAD
Other DBs
NCBI-GeneID: 661810
NCBI-ProteinID: XP_973042
UniProt: D6WWC6
Position
LG8
AA seq 309 aa
MALNLFIKRSLSTSSPMNAVIKNVTVIGGGLMGSGIAQVAAQTGHNVTIVEVNPDLIKKA
EDSIAKNLVRVAKKLHKDDPQAANKFVSESQARIKGCTDIAEAVKDSDLVVEAIVENMDV
KHKLFKNLDEVAPPKTMFASNTSSLSITEIASVTKRKDRFGGLHFFNPVPVMKLLEVVRT
PETSQETYEAFMAWGKAVGKTCVTCKDTPGFIVNRLLVPYIAEAIRMMERGDASPRDIDT
AMKLGAGYPMGPIELADYVGHDTSHAIMQGWHKKFPDNPLFKPNESVQKLIDEKKLGVKT
GEGFYKYTK
NT seq 930 nt   +upstreamnt  +downstreamnt
atggccctaaacctgttcatcaagcgaagcctttcaacttcaagccccatgaacgcagtt
ataaaaaacgtaactgtgatcgggggcggcctcatgggctcaggcatcgcccaagtggcc
gcgcaaaccggccacaacgtgaccatcgtggaagtcaaccccgacttgatcaaaaaagcc
gaagacagcattgcgaaaaacttggtacgagtcgccaaaaaactccacaaggatgacccg
caagccgctaataaattcgtgagcgaatcgcaggcccggattaaggggtgcaccgacatt
gccgaagctgtgaaagacagcgatttggtcgtggaggcgattgttgaaaacatggatgtt
aagcacaaattgttcaaaaatttggatgaggtcgcgccccccaaaaccatgtttgcgtca
aatacgagctcgctctcgattaccgaaattgcctccgttacgaagaggaaggataggttc
ggggggctgcattttttcaatcccgtgcccgttatgaagcttttggaggttgttaggact
ccggagacgtcgcaggagacgtacgaggcctttatggcgtggggcaaagccgtgggcaag
acctgcgtcacctgcaaggacacccccgggtttattgttaacaggcttctggtgccctat
atagcagaagccatcaggatgatggagagaggtgatgcttcgccccgcgatatcgacacc
gccatgaagctgggggctggctaccccatgggccccatcgaactggccgactacgtggga
catgacacctcgcacgccatcatgcaaggctggcacaagaaattccctgataaccccctt
ttcaaaccgaacgaatccgtacaaaaactaatcgatgagaaaaaactgggcgtgaaaacc
ggcgaaggcttctacaaatacaccaaataa

DBGET integrated database retrieval system