KEGG   Tribolium castaneum (red flour beetle): 661828
Entry
661828            CDS       T01046                                 

Name
(RefSeq) programmed cell death 6-interacting protein
  KO
K12200  programmed cell death 6-interacting protein
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    661828
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    661828
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    661828
Membrane trafficking [BR:tca04131]
 Endosome - Lysosome transport
  Endosomal sorting complexes required for transport (ESCRT)
   ESCRT associated proteins
    661828
Exosome [BR:tca04147]
 Exosomal proteins
  Proteins found in most exosomes
   661828
SSDB
Motif
Pfam: BRO1 ALIX_LYPXL_bnd Spc29 PSD4 ING
Other DBs
NCBI-GeneID: 661828
NCBI-ProteinID: XP_008201326
UniProt: D6WD78
Position
LG2:5891185..5899408
AA seq 846 aa
MAELLSVPLKKPSEVDIVTPLKNLIQSRYSTADKPEDCNEAISELAKLRNTAIWKAFEKY
ESSLEIIYGYYDQLVSLETKIPAQELQVPFKWKDAFDKGSIFGNRISLTIPSLGYEKICV
LFNIAALQSAVAASQSIESDESLKLAAKLLQQAAGIFNHLKSTVMLTMQQDPTPDLNPDT
LGALSNLMLAQAQEIFVHKAIHDNMKDSIVAKLASQCEDLYGECLKVFQRENLKNNWDKD
WIPTIAGKQAALHAVAQFYQSLVCRSNKQIGEEIARLEHSVSLFQTAQQRSGKASLFQEL
QHKAQRNLAEVKKDNDFIYHERIPDIKSLEPIGKAQPAKVLPIAQPMSQGFKDLFSELVP
VAVHQALAAYDVRKTEIVNTEIGRLRESTTTLNGILASLNLPAAIEVTDGSSGLPPSIIE
KANTVNQLGGINELEKMIRELPDALKRNQDILDETDRMLNEEKQADDSLRQQFKERWTRT
PSDKLNEMFRSNAAKYREIINNAVQADKVVREKFESHREGIALLSKSPTELQAAVPQGPS
GNVTNSSAVTTLRQLMEEVETIKAERDVIESELKNTNFDMKSTFLSALAKDGAISEPALS
VESLGQAYGPLQKQVRESIEKQESLIARIQQAHSQFVQERGSTASGRESKMVQLAGAHDA
FRDLLNNLTEGTKFYNDLTQLLVAFQNKVSDFCFARKTEKEELLKDLTQESSRGAVPPPT
QPSYYTGPDVKKEAPPRPPQPSQPAQPAQPPQAPQPSGVPYPVYVQGMPVPYGASTSTPY
PAYVPPPMPQGYNPYGTMPYPNSYNYPGGFPAAPGYGQQPPPGSYPQQPPAGYPPQNPGG
YPPNPW
NT seq 2541 nt   +upstreamnt  +downstreamnt
atggcagagttgttatcggttccgttgaaaaaaccgtcagaagtggatatagtaacacct
ctgaaaaatttaattcagtccaggtacagtacggctgataagcccgaagactgcaatgag
gcaataagcgagttggcgaaacttcggaacaccgcaatttggaaagccttcgagaagtat
gagagttcgttggagattatttatggatattacgaccagttggtgtctcttgaaacgaaa
attccggcccaggagttgcaagttccatttaaatggaaggacgcctttgacaagggctcg
atctttggcaacagaatcagcctaacgattccttcactcggctatgaaaaaatctgtgtc
ttgttcaacattgcggctttgcagagtgcagtggccgccagtcagagtatcgaaagtgat
gagtcactcaaattggcggcaaagttgctacagcaagcagctgggatttttaatcatttg
aaatctaccgtaatgttgactatgcaacaagaccccactcctgatttaaatcccgatact
ttgggcgctttgtccaacttaatgctagcgcaagcacaagagatttttgttcacaaggca
atccacgacaatatgaaagattctattgtggcaaaattggcgtcgcagtgcgaggatttg
tatggtgaatgtttgaaagtgttccaaagggaaaatcttaaaaataattgggacaaagat
tggatcccaacgattgcaggcaaacaggctgctctgcatgccgtggctcaattctatcaa
agtttagtgtgccggagcaacaaacaaatcggtgaagaaatcgcgaggttggaacattcc
gtttcactgtttcaaacagcccaacaacgttcaggcaaagcgtcactcttccaagagtta
caacacaaagcgcaaagaaacttggctgaagtaaaaaaagacaacgattttatttaccat
gaaagaattcctgatataaagtcactggaacctattggcaaagctcaaccggcgaaagtt
ttacccatagcacaaccaatgagccaaggatttaaagatttgtttagtgagttggttcca
gtggcggtacatcaggctttggctgcgtatgatgtgcgtaaaaccgaaattgttaatact
gaaattgggcgtcttcgagagtcaactactacgttgaatggaattttagcttcgttgaat
ttgccggctgcgattgaagttactgatggcagttcaggtctaccaccttcaattatcgaa
aaagccaatactgttaatcagttgggcggcataaacgaattggaaaaaatgataagggaa
ttaccagatgccctcaagaggaatcaagacattctggacgaaactgaccggatgttgaat
gaagagaaacaagctgatgattctttgcgccaacaattcaaagaacggtggactagaaca
ccgtccgataaattgaacgaaatgtttcgctcaaatgccgcaaagtatcgagagattatc
aacaacgctgttcaggctgataaagtcgtccgtgagaaattcgagtctcaccgcgaaggc
atcgctcttttgagtaaatcgccgactgagttgcaagcagcggtccctcaaggaccatcc
ggtaacgtaacaaattcctcggctgttaccactttaagacagttgatggaagaagttgaa
acgatcaaagcagaacgcgacgtcatcgaatcagaattaaaaaataccaactttgatatg
aaatctacatttttatcggcgctggctaaagacggggctataagtgaaccggctttgtcc
gttgaaagtctgggtcaagcttacggtccccttcagaagcaagttagagagagtattgag
aaacaggagagtcttattgcaaggatacaacaagcccattcccagtttgttcaagagaga
ggttcaacggcttctgggagggaaagtaaaatggttcaattggcgggtgctcatgatgca
tttagagaccttttgaataatttaacagaagggacaaagttttacaatgatttgactcag
ttattagtcgctttccaaaataaagtctccgatttttgcttcgcacgcaagactgagaaa
gaggagttgctgaaagatcttacacaggagtcaagcagaggggcggtgccgccgcccacc
caaccgtcctattacacaggcccagatgtgaagaaagaggcccctccgaggcccccacag
ccttcgcagcctgcgcagcctgcgcagcccccgcaagccccgcagccctctggggtccca
tatcccgtttacgtccaaggaatgcctgtaccatatggggcgtccacttcaaccccctat
cctgcttacgtgccaccgcccatgcctcaaggttacaacccatatggcacgatgccgtat
cccaattcgtataattatccaggtggatttccagctgctccaggttatgggcaacagcca
cctccggggagttatccccaacaaccaccggcgggatatcctccacaaaatccagggggc
tatccaccaaatccctggtag

DBGET integrated database retrieval system