KEGG   Tribolium castaneum (red flour beetle): 661853
Entry
661853            CDS       T01046                                 
Name
(RefSeq) E3 ubiquitin-protein ligase AMFR
  KO
K10636  E3 ubiquitin-protein ligase AMFR [EC:2.3.2.36]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    661853
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tca04121]
    661853
Enzymes [BR:tca01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.36  RING-type E3 ubiquitin transferase (cysteine targeting)
     661853
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    661853
  Multi subunit Ring-finger type E3
   ERAD complex
    661853
   LMBR1L-GP78-UBAC2 complex
    661853
SSDB
Motif
Pfam: zf-RING_2 zf-C3HC4_2 CUE zf-C3HC4 G2BR zf-RING_11 zf-C3HC4_3 zf-rbx1 zf-RING_UBOX zf-RING_5 zf-ANAPC11 Prok-RING_4 zf-RING_16 CRCB
Other DBs
NCBI-GeneID: 661853
NCBI-ProteinID: XP_015837138
Position
LG7:complement(7139939..7155269)
AA seq 532 aa
MEIDKWRVIIPRKFLKKVLKTMINMAFCWLILVGTAIQKLVFGELRVSEQQHLKDKFWNF
VFYKFIFVFGIINVQYIDEVLLWCSWFSLLGFLHLLSQLSKDRFEYLSFSPTTPLWSHVK
LLFLLTAIFTLSGFMLLVSVFVGFFGGFNTFAFMSAEVVLLSIRTLHVIIRYALHLYDMR
QEGASSVSANEENRVWEKRGPIAYYTELSFELTALIIDFVHHLHMLVWSNIFLSMASLVI
CMQLRYLFHEIQRRYKKHRNYLWVRNHLEQNYPMASSEELADNSDNCAICWEKMESARKL
PCTHLFHNTCLLSWLEQDTSCPTCRLALNIQTPSTSRIDPPDLQVDAPQPQRRQLNHFFH
FDGSRYVSWLPSFSVEVSHAQLMRQDNAPASNSQLDAMARQVQQLFPHIPISTIINDLRV
TRSVEITIENVLDGRLVAPTMYREPEVVPATNRAMSVWQASCDTDSQRNWDEFSVETVET
EDTSSLGSRFSKSSSEREKILHRRKENLIQSARKRYIEKQKAAAAAKVELQS
NT seq 1599 nt   +upstreamnt  +downstreamnt
atggaaatagacaagtggagggttataattccccgaaagttcttaaaaaaggtcctaaag
accatgatcaacatggctttctgttggctcatcctcgtgggtaccgcgatccagaagctg
gtgtttggcgaattacgcgtctctgaacagcaacatctcaaagataagttttggaatttc
gtattttataaattcatcttcgtattcggaatcatcaacgttcaatacatcgatgaggtg
ttgctgtggtgctcgtggttctcccttttgggatttctgcatctcctctcccagctcagc
aaagacagattcgaatatctgtctttttcgccgactacgccgctgtggagccacgtgaag
cttttgttcttgctaactgcgattttcacactatcgggcttcatgctgctggtgtcggtc
tttgtgggattcttcggcggatttaatacgtttgctttcatgtctgctgaggtggtgtta
ttgagtattcgtactctgcatgtgataatccggtacgccttgcatctgtacgacatgcga
caagaaggtgcgtcttcagtcagtgcaaatgaagagaatcgagtttgggaaaaacgaggt
cccatcgcctattacacggaattgagtttcgaactgacagctttaataatcgatttcgtt
catcatcttcatatgctagtttggagtaacattttcctctcaatggctagtctagtgatt
tgtatgcagttgagatatttgttccacgagattcagcggcgctacaaaaaacacaggaat
tatctgtgggtcaggaatcatctcgaacagaattacccgatggcgtcgtccgaagagttg
gccgacaattccgacaactgcgccatctgttgggaaaaaatggagtcggcgaggaagtta
ccgtgcactcatttgtttcacaacacttgtctgttgtcgtggctggagcaagacacttcc
tgtcccacttgtcgtctagccctcaacattcaaacgccctcaacgtcgcgaatcgatcct
cccgatttgcaagtggacgctcctcagccgcaacgtcgccagctcaatcatttctttcat
ttcgacggttcaagatacgtttcttggttgccgagtttttccgtcgaagtgagtcatgct
caactcatgcgacaagacaacgcgccggcgtccaattcgcaattggatgcgatggcacgt
caagtgcagcaattgtttccacacattccgatttcgacaattattaacgatctcagggta
acgaggtcggtggaaatcacgattgaaaatgttttggatggaagattggtagcgccgact
atgtatagggagcccgaggtggtgccggcgacgaatagggcgatgtcggtatggcaggct
agctgcgataccgactcgcagaggaattgggatgagttcagtgtggagacggttgaaact
gaagatacgagcagtttggggagcagattttcgaagtcttcgtcggagcgcgaaaagatt
ctccacagacgcaaagagaatttgattcagagcgccagaaaacgctacatcgagaaacaa
aaagccgccgctgctgcaaaagtggagctacaaagttga

DBGET integrated database retrieval system