KEGG   Tribolium castaneum (red flour beetle): 661949
Entry
661949            CDS       T01046                                 
Name
(RefSeq) protein Mpv17
  KO
K13348  protein Mpv17
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    661949
SSDB
Motif
Pfam: Mpv17_PMP22
Other DBs
NCBI-GeneID: 661949
NCBI-ProteinID: XP_973172
UniProt: D7EJD4
Position
LG5:680682..681589
AA seq 178 aa
MRWLFNVYETFLIRHPKVTQAVQTGLLMGAGDVISQVFVEEQPVKKLNYKRTLQFVTVGA
FYIGPALTVWYRVLDKYVGKSGKRVAITKVALDQICFAPVCLLGFMVSIGALQGKRVEEV
KHAIKETYPDILFANYKLWPAAQTINFYFVPLQYQVLYAQVVALFWNVYLCFKTKPDK
NT seq 537 nt   +upstreamnt  +downstreamnt
atgcgttggttatttaacgtctatgagacgttcctaattcgccaccccaaagtgacacag
gccgtccaaacgggcctcctcatgggtgccggggacgtgatttcgcaagtttttgtcgaa
gaacagccggtaaaaaagttaaattacaaaagaacacttcaattcgttaccgtgggggcc
ttctacatcggacctgcattgacggtttggtaccgcgttttggataaatatgtaggaaaa
agcgggaaacgtgttgcgattacgaaagtagcgctcgatcagatttgtttcgctccggtg
tgtcttttggggtttatggttagtataggggccttgcaggggaagagagtcgaggaggtg
aagcatgcgataaaagaaacatatcccgatattttattcgctaattataagttgtggcca
gcggctcaaaccattaatttctattttgtaccattgcagtatcaagttttgtatgctcag
gttgttgcgttgttctggaatgtgtatctttgtttcaagactaaaccagacaaataa

DBGET integrated database retrieval system