KEGG   Tribolium castaneum (red flour beetle): 662219
Entry
662219            CDS       T01046                                 

Definition
(RefSeq) 2-oxoglutarate dehydrogenase, mitochondrial
  KO
K00164  2-oxoglutarate dehydrogenase E1 component [EC:1.2.4.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00020  Citrate cycle (TCA cycle)
tca01100  Metabolic pathways
tca01200  Carbon metabolism
Module
tca_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tca_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    662219
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.2  oxoglutarate dehydrogenase (succinyl-transferring)
     662219
SSDB
Motif
Pfam: E1_dh Transket_pyr OxoGdeHyase_C 2-oxogl_dehyd_N R2K_2
Other DBs
NCBI-GeneID: 662219
NCBI-ProteinID: XP_008193109
Position
LG5
AA seq 1064 aa
MYRARAIVNSLTGVQGHFAGWLLVKNTAPGASCAAVRSYNVPAASEPFLNGSSSQYVEDM
YNAWLADPSSVHASWDSFFRNSASGGAGYQSPPSLAPLGRNEVPATSFLPALAGVGGTGA
VSEKVIDDHLAVQAIIRSYQIRGHHIAKLDPLGINSADLDDRTPQELLYSHYSFDNPSKT
YSEELRRQVQQFMKQDDDMDRVFKLPSTTFIGGKEKQLPLREILRRLELTYCRHIGVEFM
FINSLEQCNWIRQRLETPGAMEISADEKRLILARLTRATGFESFLARKWSSEKRFGLEGC
EILIPAMKQVIDKSTEFGVESIVMGMPHRGRLNVLANVCRKPLHQLFTQFAGLEAADDGS
GDVKYHLGTYIERLNRVTNKNIRLAVVANPSHLEAVDPVVQGKTRAEQFYRGDGEGKKVM
SILLHGDAAFCGQGIVFETMHLSDLPDYTTHGTVHIVVNNQIGFTTDPRHSRSSAYCTDV
ARVVNAPIFHVNSDDPESVMHVCNMAAEWRATFHKDVVIDIVCYRRNGHNEIDEPMFTQP
LMYRKIKNTKSVLEKYSEQLVKENVVTTEEVKDVKAKYEKICEDALESARKETHIKYKDW
LDSPWSGFFEGKDPLKASPTGVKEDTLVHIGKRFSSPPPNAAEFVIHKGIERILKARMEM
VEARTIDWALGEAMAFGSLLKEGIHVRLSGQDVERGTFSHRHHVLHHQTVDKATYRPLCN
LYPDQAPYTVCNSSLSEFGVLGFELGYSMTNPNALVIWEAQFGDFNNTAQCIIDQFISSG
QAKWVRQSGLVMLLPHGLEGMGPEHSSARLERFLQMSSDDPDYFPPESDEFAVRQLHDIN
WIVANCTTPANLFHILRRQIALPFRKPLILMTPKSLLRHPEARSSFDEMLENTEFMRIIP
DKGAASQNPQNVKKVLFCSGKVYYDLRKAREERKLDNDIVITRVEQISPFPYDLIKNECA
KYPNAQLCWAQEEHKNQGSWSYVQPRFETALTGSRDVITDNDARGWFAKFFGKKPPKPQP
VTETLPETRVVSYVGRPTAASPATGSKAQHLKELANLLDDAMAL
NT seq 3195 nt   +upstreamnt  +downstreamnt
atgtatagggccagagcgatcgtaaacagcctcactggggtccagggacacttcgctgga
tggctccttgtcaaaaacacagcaccgggggctagttgcgcggctgttaggagctacaat
gtacctgctgcttctgaaccttttctgaacggaagctccagccaatatgttgaggacatg
tacaatgcctggctggcggacccctcgagtgtccacgcatcatgggattccttcttccgg
aattcggcttccggtggggccgggtaccagtcgcccccatccttggccccccttggccga
aacgaagttcctgcaacttcctttttgccagctttggccggtgttggcggaaccggagcc
gttagcgagaaagtaatcgacgatcacttggctgttcaggcaattatccggagttatcag
atcagaggacatcacatagctaaactggacccgttgggaatcaacagtgccgatttggac
gaccggacaccccaggaattgctgtattcccattacagtttcgacaacccgtccaagact
tactcggaagaactgagacgccaggtccagcagtttatgaaacaggatgacgacatggat
cgagttttcaaattaccatcgacgactttcatcggcggcaaagaaaaacaattacctttg
cgcgaaattcttcgtcgtttagaactgacttattgtcgccatatcggcgttgagtttatg
ttcatcaacagcttggagcaatgcaattggatccgacaaagattggaaactcccggcgct
atggagattagcgccgacgagaaacggttaattttggctcgtttgacccgcgcaaccgga
tttgaatcattcttagcgcgtaaatggtcatcagagaaacgcttcggtttggaaggttgc
gagattctaatcccggccatgaagcaagtcattgacaaatcgaccgagttcggcgtggag
agcatcgtcatgggcatgccgcatcgtgggcgcctcaacgtcctcgccaacgtctgtcgc
aagcctttgcaccagctcttcacccagttcgccggcttggaggccgctgacgacggctcc
ggcgacgttaaataccacctggggacctacatcgagcggttgaaccgcgtcacgaacaaa
aacattcgcttggcggtcgttgcgaacccgtcgcacttggaggccgtcgatccggtcgtc
cagggaaaaacgcgcgccgagcagttctaccgaggcgatggcgagggcaagaaggttatg
tcgattttgctgcatggagacgctgccttctgtgggcaaggcatagttttcgaaacgatg
catttgtccgatttgcccgactataccacgcacgggacggttcacattgttgttaataac
cagatcggttttacgacggatccgcgacactcgcgttcgtcggcctattgcacggacgtg
gcacgtgtggtcaacgcgccgattttccacgtgaactccgacgatccggagagcgtgatg
cacgtgtgtaacatggcggcggaatggcgggccacgttccacaaagacgtggttattgac
attgtctgctaccgccggaacggtcacaacgaaatcgacgaaccgatgttcacgcaacct
ctcatgtaccgaaaaattaagaatacgaagtcggttttggagaagtattccgaacagttg
gtcaaggagaacgtcgtgacgaccgaagaagttaaagatgtgaaggccaagtacgagaag
atttgcgaagatgcgcttgagagtgcgcgcaaggaaacacatatcaagtacaaggattgg
ttggatagtccctggtcgggcttcttcgaggggaaggatcccttgaaggcgagtccgacg
ggagttaaggaagacacgttggtgcatattgggaagaggttttcgtcgccgccgccaaat
gccgccgagtttgttatccataagggtattgagaggattttgaaggcgaggatggagatg
gttgaggcgaggaccattgattgggcgttgggtgaagctatggcttttggctccttgctg
aaggaggggattcatgtgaggttgtcgggacaggatgtcgaacgtggtactttctcacat
aggcatcatgttttgcatcaccagactgtggataaggctacctacagacctttgtgcaat
ttgtaccccgaccaggccccctacacagtctgcaacagttccctgtctgaattcggtgtc
ctcggcttcgagctgggctactccatgaccaaccccaacgccctcgtcatctgggaggcc
caattcggcgacttcaacaacaccgctcaatgcataatcgaccaattcatctcatcgggt
caagccaaatgggtgcgtcaaagcggtctcgttatgcttctcccccatggtcttgaaggc
atgggtccggagcactccagcgcccgtcttgagcgtttccttcaaatgtcctcagacgat
cccgattatttcccacctgaaagcgacgaattcgccgttagacagctgcatgatatcaat
tggattgtcgcaaattgcaccacaccggcgaatcttttccatatcttgcggcgacagatt
gctttgcctttccgcaaaccgctgattttgatgacaccgaagagtttgttgcgtcatcct
gaagccaggagtagttttgatgagatgttggagaatacggagttcatgaggattattccg
gataaaggcgctgccagtcagaatccgcaaaatgtgaagaaggtgctgttctgtagcggg
aaggtttactatgatttgagaaaagcccgcgaagagaggaagttggataatgatattgtt
atcacccgtgtagaacaaatctcgccgttcccttacgacttgattaagaacgagtgtgcc
aaataccccaacgctcaattgtgctgggcccaagaggagcacaagaatcaaggttcctgg
agttacgtgcagccccggttcgagacagctttgaccggttcacgagatgttattacggat
aacgatgctagaggttggttcgctaaatttttcggcaaaaagccgcctaaacctcaacca
gtgactgaaactttaccagagactagagtcgttagttatgttggaagacctaccgctgct
agccctgccactggaagcaaagcccaacatttgaaggagctggcgaaccttttggacgac
gcgatggcattgtag

DBGET integrated database retrieval system