KEGG   Tribolium castaneum (red flour beetle): 662226
Entry
662226            CDS       T01046                                 
Name
(RefSeq) putative fatty acyl-CoA reductase CG5065
  KO
K13356  alcohol-forming fatty acyl-CoA reductase [EC:1.2.1.84]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00073 Cutin, suberine and wax biosynthesis
    662226
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    662226
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.84  alcohol-forming fatty acyl-CoA reductase
     662226
SSDB
Motif
Pfam: NAD_binding_4 Sterile Epimerase 3Beta_HSD GDP_Man_Dehyd Polysacc_synt_2 RmlD_sub_bind KR
Other DBs
NCBI-GeneID: 662226
NCBI-ProteinID: XP_008194832
Position
LG6:complement(4209645..4220079)
AA seq 528 aa
MVSVRNEMAAIQNGVCSSHTGVAEFYNGKTVFITGGTGFMGKVLLEKLLRACPGVAKIYL
LIRPKKGQDAHERLKLLLCSPLFDPIRKSRPSDLHKVLPIEGDITQPELAISSNDRLTLA
RTVNIVFHSAATIKFDEKLKLSVTINMLGTQRLVELCKRMTNLEALVHVSTAYCNCDRSE
VKETIYPPPMGPDQVTSLVDCLDESLLDSLTSRLVGNRPNTYTFTKALAECWLKENKGDL
PLVIVRPSIVLCSFGGPLKGWVDNWNGPTGIIAAAGKGLFRTMLCDPEKIADLVPVDMVI
NLMLVAAWRIGTTKTKDMPIYNCSTGQRRPITWKHFVGLCFKYMRKHPFSDVTWYPDGTV
TASRTLNIINKYLLHWLPAYIMDGLVWMAGGKPIMVRIQDKLCKAATCLEYFTMNEWHFD
DENVRILSQQLNEKDREEFCFDVAKIDWEQYVEDYVLGIRRFIFKEESSSIPHARRQVSR
LYWLYRCLQVASVMCMWHFLTLRYAPLRQLWGNALRLLIHLARMLPFV
NT seq 1587 nt   +upstreamnt  +downstreamnt
atggtgtccgtaagaaacgaaatggccgccattcaaaacggagtttgttcgtcgcacaca
ggcgttgccgagttctacaacggcaaaactgttttcatcacaggcggcaccggcttcatg
ggtaaagtactgctcgaaaagttgctcagggcgtgtccaggagtggccaaaatctacctt
ctcatcaggcccaagaagggccaagacgcgcacgaacgcctaaaactgctactgtgttca
ccgctgtttgatccgattcggaagagtcgtccgtcggatctgcacaaggtgttacccatc
gaaggcgatataacacagcctgaattggcgataagttcaaatgatagattaacattggct
agaaccgtcaacattgtttttcatagcgcagcaacgataaaattcgacgaaaaattgaaa
ttatcggtgactattaatatgctagggacgcaaagattggtcgaattgtgcaaaagaatg
acgaatttggaggctttggtgcacgtgtccaccgcctactgcaattgcgaccgtagcgaa
gtaaaagagaccatttacccgccacctatgggtcccgatcaagtcacctcattggtggat
tgtttagatgaaagccttctcgattcgttaacgtcacgtcttgtgggaaatcggcccaat
acttatacgtttacgaaagcattggccgaatgctggttaaaagaaaacaaaggcgattta
ccattggttatcgtacgaccaagtatagtcttgtgcagttttggtggacctttaaaaggc
tgggttgataattggaacggtccaacgggtattatcgcggcggctgggaaaggactcttc
cggacgatgttatgcgatccggaaaaaatcgccgatctagtgcccgttgacatggtcatt
aatttaatgctggtggcggcgtggcgaatcggaacgaccaaaaccaaagacatgcccatt
tataattgtagcacaggtcaaaggaggccaataacgtggaaacattttgtcggtttgtgc
ttcaaatacatgaggaaacacccattttcggatgtcacgtggtatccggatgggacggtg
acggcgtcccgaactttgaatataattaataagtatttgttgcattggttaccggcgtat
attatggatgggttggtttggatggctggggggaagcccataatggttcgtatccaggat
aagctgtgcaaggcggccacgtgcctggagtacttcacgatgaacgagtggcatttcgac
gacgagaacgtgcgcattttgagccaacagttgaacgagaaagatcgcgaagagttttgt
tttgacgtggcaaagatcgattgggaacagtacgtggaggactatgttctcggcatccga
cgtttcattttcaaggaggagtcatcatcaataccacacgcgcgccgccaagtgtcgcgt
ctctattggttgtacagatgtttgcaggtggcgtcggtgatgtgcatgtggcattttcta
acgttacgttacgcccccttgcggcagttgtggggcaacgccctcagactgctcattcac
ttagcccgaatgctgccatttgtatag

DBGET integrated database retrieval system