KEGG   Tribolium castaneum (red flour beetle): 662229
Entry
662229            CDS       T01046                                 

Name
(RefSeq) protein 4.1 homolog
  KO
K23961  band 4.1-like protein 1/2/3
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04990 Domain-containing proteins not elsewhere classified [BR:tca04990]
    662229
Domain-containing proteins not elsewhere classified [BR:tca04990]
 Other domain-containing proteins
  FERM domain-containing proteins
   662229
SSDB
Motif
Pfam: 4_1_CTD FERM_C FERM_N FERM_M FA
Other DBs
NCBI-GeneID: 662229
NCBI-ProteinID: XP_008196359
Position
LG7:13800589..13816015
AA seq 2676 aa
MPGEKKMAIDNDSSPAKSKSSTLGRSTGNTLAHVTMLDGTVLDVSIERKAKGKDLLDKVC
EAINLIEKDYFGLVYADRHDPRNWLDLDKRISKFLKSEPWKFSFQVKFYPPDPAQLQEDI
TRYQLCLQIRNDILSNRLPCSFVTHALLGSYLVQSELGDYDPETMGRNYLKDFKFAPNHT
QDLEDKVIELHRTHKGQTPAEAELHYLENAKKLAMYGVDLHPAKDSEGVDIMLGVCASGL
LVYRDRLRINRFAWPKILKISYKRHNFYIKIRPGEFEQFESTIGFKLANHRAAKKLWKTC
VEHHTFFRLMSPETNQKSSLFPKLGSKFRYSGRTHYETKKTPIDRPAPQFERSLTGKRLA
SRSMDPLGGSHPEDDYNEANKRHTMSHPPEHIPDIDNQSPAKVKSPKEKKEKKEKLARKG
SGAGSAASISSGSSVEGEYEAEKNQKKPIGGVAVLPTGSLFGKKKEKDDKDKDKENKDVN
APDQNGTDVDLNSSGEAETPGKDKKEKSKSPGFLFGSKRDKSPKEKKEKVAVAEKAPEKG
GPPLGSPQLPGYTREYDYDDEQGTPKKPFTPIGFNYEQQKSPSSPKSDPESQQSPSTKRA
TGLAFNYAPGEDDKLKKLSPGFKDPKADTAAFLAGEQYMHEAPLEKTAKPGAVAAATPIP
AVPGAKKRLVKLFVITGKKDPKTGRIDLENASVDVTEAQQVVETGLIDSKYGLLDPGNGT
VIITDPQNGQKEVVQGHIDPITKQIIITSGSVIDPKSGKRDSTLGQIISISGQQKHPITS
PLAIAPKKRVVKVTVVTAKKDPKTGRIEIEKGTTENLDASLDPMTGHIDTKYGIIDPVNK
KIAHKDPKSGKTDVRSVEIDPNLGQILVKDGVVDSKSGKVDNSLGQVITITEEGDAIVPI
TAVTAKRDPKTGQLDPTQAHKETTNGKIDNKHNLIVTKYGSIDVKNKKILTRDPKTGKVE
ERPVQFDAQDNIIILSGIVHPKTGVKDDNLSQILQVGPEADPEVKIISVSGKVDKKGLDP
KNLSPAEESTGLYDPDTNKIYTKYGVFDPIEETLSYFDPKTGKTEIKQGQRDPSSGEILF
RGLVNPKTGKVDNNFGRTIKVDVKGQKVDPAAVNQPRALDDVKKPVAVSPVKLPGPPPFV
PKEKNKMVKLLVITAKRDPKTGHLDVENGHVDQSAGILHPTGEIDSKYGLIDPKKGTVTF
TDPATAKKETVQGQVDPVSGQIQIVNGPVLDPKSGKKDNNLGQVITVVGTGEVKEPKQPV
KHALKSHPIPKKRVIKILVITSKKDPKTGRIDTEKGTVEKLTATVDPVSGIIESKYGKID
PQNEKIVQKDKSGKAVVTPIKIDENTGQIYINDNIVDKNGKVDPNLSQVINVVDPQHPAV
VITTITARKDPKTGAIDLANGRIETTNGKIIPDTGEIVTKQGTINLKLMRITTRDPKTGQ
VHEKPVTVDKDDNIIISGGVIDPKTKTVDPNMVQVVQVGNEVDPEIQITTYVGKVDSKKN
TIDSKNAVPDTTPGLYDPDKNQIYTKYGILDPVEDTLIVTDPKTGKTDTRPGHIDSNTGE
LIFKGGFVNPKNGKVDKDLGRAISVHITEPAIDPVTSQQPSEKELQRVATTVPKPVEAKP
AQPSAVQSAAIPAKAASGDTLVPKRRIVKIMVITSKKDPKTGFVDTENGQVEQITGIVDP
ATGFIETKYGQIDPKSGSLITRDTATGNIEKVPGKVDPTTGQITVTGGPVIDPATGKPDN
TLGQVFSVVGLKQAQDPNAAPIPKKRIIKITVITTKIDPKTGKIDSEKGQIEQSTALLNP
ETGLIESKYGLIDPKSGKLIINDPKSGKIDAKSAQVNENNGQVIVSSGVVDPKSGKVDNS
LGQIISIAGQSDPVVEITTITAKKNPVTGAVDVNNGQMENSKGKKISATGEVVTKYGTID
LKSGKITSVDPKTGKSESRPIQIDPEGNVIITSNVKDPKTDSVNPDLGQVIKIGSEVEPE
VHVITFVGKVDPKKNTIDVKNITPEISNALYNPSTHKIDTKYGQLDPVKGTLTYVDPKTG
RQEVKQGHIDPHTGQVLFKGGYVNPKTGKVDPYFGRIMSVIMNDPQVNKSGEIVPRTVDN
IKIDPKTNQVWVFDHHDNVSKQDVYSTGHIDPVTGYVITVYGTIDPKSGAISKIVKVDPS
NAKIDPETHQVFTKTGEMDESGAPLYAASEIDQKSGNIYTKYGKIDPKTGKLVIIRIYML
NESDPSGKVKEIDPKDCQFDEKTGKIINVTTQTVYIYTMLDPKTGKIIQVNPNDPMVKSS
NTKVSQVLTLSGEIDPVTGKIHTEWGDIDPDTLDIDPKTARRDPVTGQLILNYAQIDLSH
FPDLKDTKIKVKTYKDDDSNASSDDDLNEYAADNSKDLPNLSIKTAKSPTTPVIVKTTTK
QIVTKDKDGVTQNIEERVEDGRTGEITVSTHVNKADAPIDDGKSPFVTARAVTTRTATTH
EDLGTNARTQQLEEKTVAHSMTSSATRQEQRTVTQEVKTTSTVVSGDQLGRRDSVSSTSS
GDSGTPIDPPDDPNHPYYNSNVYKDVPGGIVQTESVVYSGDPTIHHTSTTSVPVVATEAR
KVHLASDDGNYSATGEIVSSQTISSKTRTVETITYKTERDGVVETRVEQKITIQSDGDPI
DHDRALAEAIQEATAMNPDMTVEKIEIQQKTAQPPQ
NT seq 8031 nt   +upstreamnt  +downstreamnt
atgcctggcgagaaaaaaatggcgattgataacgattcatctcctgccaaaagcaagtct
tcgactttgggtcgaagcacaggtaacactttggctcatgtgacgatgctggatggcact
gtattggatgtcagcatcgagcggaaagccaaagggaaagacctgctcgataaagtatgc
gaagcgattaatctaatcgagaaggattatttcggtcttgtctacgcggacagacacgat
cctagaaactggctagacctcgacaagagaatttcgaagtttttaaaatcggagccttgg
aagtttagtttccaagtgaaattctaccctcccgatcccgctcaactacaagaagacatc
actcgctaccagctgtgtcttcaaatccgcaacgatattttaagtaatcgtttgccttgt
tcttttgtcactcatgccttgctcggttcgtatctcgttcagtccgaactgggcgattac
gatcctgaaactatgggacgcaactacttgaaagattttaaatttgcccccaaccatact
caggatcttgaagataaagtcatcgagctccaccgaacccacaagggacaaactccagcc
gaagcagaattgcactacttagagaatgccaaaaagttggcaatgtacggcgttgacctg
cacccagcgaaagactcggaaggtgtcgatattatgttaggtgtctgtgcgtctgggctt
ctagtttatagagacaggcttaggatcaaccggtttgcttggcccaaaatcctcaaaatt
agctacaaacgccacaatttttacataaaaattcgaccaggagagttcgaacaattcgaa
tccaccatcggtttcaagctagctaaccatcgggcggccaagaagctttggaagacttgt
gtggagcatcacactttcttcagattgatgtcccctgaaaccaaccaaaagtcttcttta
ttccccaaactcgggtccaaattccgatactccggacgaactcactacgaaacgaagaaa
actcccattgaccgacctgccccacaattcgaaaggtctttaactggcaagcgtttggcc
tcccgtagcatggaccctctgggaggttcgcaccctgaagatgactataacgaggccaat
aaacgccacacaatgtcccaccctccggaacacattcccgatattgataatcagagtccg
gcgaaagtaaaatcgccgaaagaaaagaaggagaagaaggaaaagcttgcacggaaaggc
agtggtgccggatcggcggcttcgattagttccggcagttccgtggaaggggaatacgaa
gccgagaaaaatcagaagaaaccaattgggggcgtcgccgtattaccaactggtagttta
ttcggcaagaaaaaagaaaaggatgataaggacaaagataaagaaaataaagacgtcaat
gcacctgaccagaacggcactgacgtggacctcaattccagcggagaggccgaaacacct
ggcaaagataagaaagaaaagtcaaagagccccggtttccttttcggttctaaacgtgac
aaatccccgaaagagaagaaagaaaaggtcgcggttgccgagaaagcgccggagaagggc
ggacctcctctaggttcccctcagcttcctggctatactcgcgagtacgattacgacgac
gaacaaggtacccccaaaaaacccttcactcccatcgggttcaattacgaacaacagaaa
tccccctcgagccccaagagcgacccggaaagccaacagtcaccttcgacgaaaagggca
acgggcctggctttcaattacgcaccaggtgaagacgataaacttaaaaaactcagtcct
ggattcaaggaccccaaggctgatactgccgcgtttctggccggggagcaatacatgcac
gaggccccactcgagaaaactgcgaaaccgggggctgtggcggcggcaacccccatcccg
gctgtccccggggcgaaaaaaaggctcgttaagttgtttgttatcaccgggaagaaagac
ccgaaaacggggaggattgacttggaaaatgcgagtgttgatgtgacggaagctcaacaa
gttgttgagactggcttgattgactcgaaatatggactgctcgatcctgggaatggcact
gtcattatcactgatccccagaatgggcaaaaggaagttgtccaaggtcacattgatccg
atcactaaacaaatcattatcacttcgggatcggtcattgatccgaagtcgggtaaaagg
gattcgactttgggtcaaatcatttcaatttcgggacaacagaaacacccaattacaagt
cccttggctatagcacccaaaaaacgggtggttaaagtaactgtggttaccgcaaagaag
gatcctaagactggacgaattgaaattgaaaaaggtactacagagaatctggacgctagt
ttggatcctatgactggtcatatcgacaccaaatatggaatcatcgacccggttaataaa
aaaatcgcccataaggaccccaagtctggaaaaaccgacgttcgttcggtagaaatcgac
cctaatttgggccaaatccttgtcaaggacggcgtagttgactcgaaatctggcaaagtc
gataatagtttaggccaagtgattaccatcactgaagaaggcgacgctatcgtccctatc
actgctgtaacagcgaaacgggaccccaaaaccggtcaattggacccaactcaggcacat
aaggaaaccaccaatggcaaaatcgacaacaaacataacttgattgttacaaaatacggt
tctatcgatgttaaaaacaagaaaatcctgacacgtgatcccaagaccgggaaagtcgag
gaacggccagtccaattcgatgctcaagacaacataatcattttgagcggaatagtacat
cccaaaacgggagttaaggatgataatctcagccaaattctccaagttggtcccgaggct
gaccccgaagtgaagattatttcggtttcgggtaaagtcgataagaagggactcgatccg
aagaacttatctccggcggaagaatcaaccgggttgtacgaccctgacactaataaaatc
tacacgaagtatggcgtttttgatcctattgaagaaaccctgagttatttcgatcccaaa
actggtaaaaccgaaatcaagcaaggacagcgcgaccccagttccggtgaaatcctgttc
aggggattggttaatcccaagactgggaaagttgacaacaatttcggtcgcacgattaaa
gtcgacgtcaagggacagaaagttgatcctgctgctgtcaatcagccacgggctttagac
gatgttaaaaaaccagtcgctgtgtctccagtcaagttaccggggccgccaccattcgta
cccaaagagaagaacaaaatggtcaaattattagtaataacggcaaagagagatccgaaa
actggtcacttggacgtggagaatggccatgtggaccagtcggccggtattttgcaccca
actggggaaatcgactcgaaatatggcttaattgacccgaaaaaaggcacggtaacgttt
actgatcccgcgacagccaagaaagaaacggtccagggacaagttgatccagtttctggc
caaattcaaattgttaacggaccagtcctcgacccgaaatcgggcaaaaaagataataat
ttggggcaagtaatcacagttgtgggtactggtgaagtcaaagaaccaaaacaaccagtc
aagcatgctcttaagtcgcatccgattcccaagaagcgcgtcattaaaattctggttatt
accagtaagaaagacccgaaaactggccgaattgataccgagaaaggtaccgttgagaaa
ttgactgcaactgttgatccagtcagtggaatcattgaatcgaaatacgggaaaatcgat
ccacaaaacgagaaaatcgtccagaaagacaaatcagggaaagccgttgttacaccgatc
aaaatcgacgaaaacactggccagatctacattaatgacaatatcgttgataagaatggc
aaagtcgacccgaatttgtcccaagtcattaatgttgtcgatccgcaacaccctgctgtt
gttattacgaccataacggcacgaaaagaccctaaaaccggcgctattgacctagcgaat
ggacgaatcgagacaaccaacggaaaaatcattcccgacactggtgaaattgtcaccaaa
caaggaacaatcaatttgaagttaatgagaatcacaacacgtgatcccaagaccggccaa
gtgcacgaaaagcctgttacagttgataaagacgataatattatcatttcgggtggtgta
attgatccgaaaacaaaaactgttgatccgaatatggtccaagttgtgcaagtcggaaac
gaggttgatccagaaattcaaataacaacatacgttgggaaagttgattcgaagaagaat
acgattgattccaagaatgctgttcccgacacaacgccgggactttacgatcccgataaa
aaccaaatttacaccaagtatggtattttggatccggttgaggacacgttgattgtcact
gaccctaaaactgggaaaactgacaccaggcctggacacattgactcaaacactggtgaa
ttgatattcaagggtggtttcgttaatccaaagaacggtaaagttgacaaggatctggga
cgggctatttccgtccatattaccgagcctgccatagatccagtcacctcacaacaaccc
tccgagaaggaattgcaaagggtggcaaccactgtgcctaaaccggtggaagctaaaccc
gcacagcctagtgcggtacagagcgctgcaataccggccaaagcagcatcgggtgatacg
ttagtacccaagcgacgtatcgtcaaaatcatggtaataacatcgaaaaaggaccccaaa
actggctttgttgacaccgaaaatggccaagtggaacaaatcaccggaattgtggacccg
gctaccggtttcattgaaaccaagtatggacagattgaccccaaatccggatcgttgata
acccgtgatacggcgaccggaaacattgaaaaagttccgggtaaagtcgatccaacaacg
ggtcaaatcacagtaaccggaggcccagtgattgatcctgcgaccggaaaaccggacaac
accttaggccaggtgttttcagtagtggggttgaaacaagcccaggaccccaacgcagct
ccaatccccaagaaacgcatcattaagattacagtgattacgacgaaaattgatcccaaa
actggcaaaattgattcagagaagggtcaaatcgaacagtcgaccgcgttattgaaccct
gagactggtcttatcgagtctaaatacggtttaattgaccctaagagcggtaaattgatc
attaatgaccccaaatctgggaaaatcgacgccaagtcggcccaagtcaacgaaaataac
ggccaagttatcgtcagtagcggagttgttgacccgaagagcggaaaagttgacaattcc
ctcggacaaattattagcatcgcgggccagagtgatccggttgttgagataacgacaatc
acggcgaagaaaaatccggtcaccggagctgttgatgtaaataatggccaaatggagaat
tcgaaaggtaaaaagatttcggccaccggcgaagttgtgacgaaatacggaacaatcgat
ttgaaatctggaaaaatcacaagtgtggaccccaagaccggtaaaagtgaatccagaccg
attcaaatcgatccggaaggcaatgtcattattacgagcaatgtgaaagatccgaaaacc
gatagcgtgaatccggacctgggccaggttattaaaatcggatcggaagtcgagccggaa
gtccatgtcatcacgtttgttggcaaagtcgatccgaagaaaaacacaatcgatgttaaa
aacatcactccggaaatttccaacgctctctacaaccccagtactcacaaaattgatacg
aaatacggccaacttgacccggttaaaggcactctgacctacgtggaccctaaaaccggt
cgccaggaggtcaaacagggccacattgaccctcacaccggacaagtcttgttcaagggc
ggttacgttaatcccaaaactggaaaagtcgacccttacttcggtagaatcatgagtgtg
ataatgaatgaccctcaagtgaataaatcgggagaaattgtcccaagaactgtcgacaat
atcaagattgatcccaaaactaaccaagtttgggtgtttgaccaccacgataatgttagt
aaacaggacgtttattccaccggtcatattgacccagttactggctatgtcataacggtt
tacggcacaatcgacccgaaaagtggggccatttcaaaaattgttaaagttgaccccagc
aacgctaaaatcgaccctgagactcaccaagttttcacaaaaactggagaaatggacgag
agcggagccccgttgtacgccgcgtctgaaattgaccaaaaatcaggcaacatttacacg
aaatacggcaagatcgatccgaaaacaggcaaattggtgataattcgcatctacatgctc
aacgagtccgacccgagtggcaaagtcaaagaaatcgacccgaaagattgccagtttgac
gaaaaaaccgggaaaataatcaatgtgaccactcagactgtctacatttacacaatgctg
gacccgaagaccggcaaaatcatccaagtcaatcccaacgaccctatggtgaagagctcc
aacacgaaagtgtcgcaggtgttgaccctttctggcgagatcgatcccgtgacgggtaaa
atccacaccgagtggggcgacatcgatccagacactctggatatcgacccaaaaacggct
cggcgggaccctgttaccggccagttgattttgaattacgcccagatcgacttgagtcac
ttccctgacttgaaagacacgaaaattaaagtgaagacgtacaaggatgacgattcgaat
gcttcgagtgacgacgatttgaacgaatatgcggctgacaattcgaaagatctaccgaat
ctttcgataaaaacggccaagtctccgacgacacctgtcattgtcaagaccaccaccaaa
cagatcgtgacgaaggataaagatggggtgacgcagaatatcgaagagagggtggaagat
ggacggacgggagaaatcacggtttcgacacatgttaataaggccgatgcaccgatcgat
gatggtaaatcacctttcgttaccgcccgtgctgtaacgacacgtaccgctacaacgcac
gaagatctaggcactaacgcacgcactcaacaactcgaagaaaaaaccgtggcccattcg
atgacatcaagtgcgacaagacaagaacagcgcactgtaacccaggaagtaaaaacgacc
agtactgttgttagtggagatcagctgggcagacgagatagtgttagctcgactagttca
ggtgattcaggcacacccattgatccaccagatgatccaaatcatccatattacaacagc
aatgtctacaaggatgttccgggaggtattgtccagacagaaagcgttgtttatagcggc
gatcctaccatacatcacaccagcacgacttcggtgccagtggtggcaactgaagcaaga
aaagtccatttggcttcggacgacggcaattacagtgcgactggcgaaattgtgagctcc
caaactatcagttctaagaccagaactgttgaaacaatcacttacaaaacggaacgcgac
ggtgtggtggagacaagagttgagcagaagattaccattcaatcggacggagaccccatc
gaccatgacagagccctagctgaagccatccaggaagccacggctatgaacccagacatg
acagttgagaaaattgaaattcaacaaaagacggcacaaccgcctcaataa

DBGET integrated database retrieval system