KEGG   Tribolium castaneum (red flour beetle): 662379
Entry
662379            CDS       T01046                                 
Name
(RefSeq) proteasome subunit beta type-6
  KO
K02738  20S proteasome subunit beta 1 [EC:3.4.25.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03050  Proteasome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03050 Proteasome
    662379
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    662379
  09182 Protein families: genetic information processing
   03051 Proteasome [BR:tca03051]
    662379
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.25  Threonine endopeptidases
    3.4.25.1  proteasome endopeptidase complex
     662379
Peptidases and inhibitors [BR:tca01002]
 Threonine peptidases
  Family T1: proteasome family
   662379
Proteasome [BR:tca03051]
 Eukaryotic proteasome
  Core particles (20S proteasome)
   beta type subunits
    662379
SSDB
Motif
Pfam: Proteasome
Other DBs
NCBI-GeneID: 662379
NCBI-ProteinID: XP_973571
UniProt: D6WT45
Position
LG7:13793821..13794831
AA seq 224 aa
MPPVTSDYGMNAESDWMNAAHSTGTSIMAAEFNGGVIIGADSRTTTGAYIANRVTDKLTK
VTDHIYCCRSGSAADTQAIADIVAYHLSFHGMELGEEPLVETGAAVFRELCYNYRDSLMA
GILVAGWDKRKGGQVYSIPIGGMCVRQQVSIGGSGSSYVYGYVDANYKPNMSKEECVKFI
TNTLALAMSRDGSSGGVVRLGIITEEGIERRVVLGDQLPKFFEG
NT seq 675 nt   +upstreamnt  +downstreamnt
atgccacctgtaacaagtgattacggcatgaatgctgaaagtgactggatgaacgctgcc
cacagcactggtacctctattatggcagcggaattcaatgggggcgtaattattggggcc
gattctcgaaccactacgggagcatacatcgcaaatcgtgtcacagacaaactgactaaa
gtaaccgaccatatttactgctgccgctctggctccgcggccgatacccaggctattgcg
gacattgtggcctaccatctaagttttcatggaatggagttaggggaagagcctttggtg
gagacaggggctgcggtttttcgcgagttgtgttacaactatcgtgattccctaatggcc
ggtattctggttgcgggttgggataaacgtaaaggggggcaagtgtactcaatccccatt
ggaggcatgtgtgtgagacagcaggtctccattgggggttcaggctctagttacgtgtac
gggtacgttgacgccaactataaaccgaacatgtcgaaggaagagtgtgttaaattcatt
acaaacactttggcactcgcaatgtcacgcgatggttcttcgggtggtgtggttagatta
ggaattattacagaggagggaatcgagcgcagagtggtcttgggcgaccaactgccaaaa
ttctttgagggttaa

DBGET integrated database retrieval system