KEGG   Tribolium castaneum (red flour beetle): 662443Help
Entry
662443            CDS       T01046                                 

Definition
(RefSeq) MAP kinase-activated protein kinase 2
  KO
K04443  mitogen-activated protein kinase-activated protein kinase 2 [EC:2.7.11.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tca01001]
    662443
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.1  non-specific serine/threonine protein kinase
     662443
Protein kinases [BR:tca01001]
 Serine/threonine kinases: CAMK group
  MAPKAPK family [OT]
   662443
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Kdo
Motif
Other DBs
NCBI-GeneID: 662443
NCBI-ProteinID: XP_008193509
UniProt: D6W792
Position
LGX
AA seq 358 aa AA seqDB search
MNREMRQSHRTPKKTPITDDYDITKTVLGLGINGKVVECFSKATKEKFALKILVESQKAR
REVDLHWQASGCRHIVNIIDVYENKYNNNPCLLVVMECMEGGELFQRIQDKPDGAFTERE
AAQIMHEICIAVKYLHDNNIAHRDLKPENLLYSKKGTYGILKLTDFGFAKETLVKDTLQT
PCYTPYYVAPEVLGPEKYDKSCDVWSLGVIMYILLCGFPPFYSNHGLAISPGMKNRIRMG
QYTFPNPEWQNVSQDAKDLINGMLNVDPAKRLTIDQVMSNRWIAQYTAVPQTPLHTHKML
KEGEEMWPEVQEEMTRSLATMRVDYDQVHIKTLENSNNPLLNKRRKRSANQVTLKEQK
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
atgaatagggagatgcggcaaagtcacaggacaccgaagaaaacgccaattactgacgat
tacgacattactaagacggttttaggcctcgggatcaacggtaaagtcgtcgagtgtttt
tctaaggctacaaaagagaagttcgctctaaagatacttgtcgagagccagaaggctaga
agggaggtcgatttgcattggcaagccagtggctgccgccacatagtcaatataatcgac
gtctatgagaataaatacaataacaacccttgtttactagttgtgatggaatgcatggag
ggcggagagctgttccagcggattcaggataaacctgacggggctttcactgagagagag
gcggcacagatcatgcatgagatatgcattgcggtgaaatacctacacgataataacatt
gcacacagggacttaaaaccagagaatttactttactcaaagaaaggtacttacggtata
cttaagttaactgatttcggctttgctaaggaaactttagtgaaggacacccttcagacg
ccttgttatacaccatattatgttgctcctgaagttttagggcctgagaaatacgataag
agctgtgatgtttggtctttaggagtcattatgtacattttgttgtgcgggttccctcca
ttttatagcaatcatggcttggcgatttcgccaggaatgaaaaataggatacgaatgggc
caatacacattccctaatcctgagtggcaaaatgttagtcaagacgctaaagaccttatt
aatggtatgcttaacgtggatccggccaagcgactgacaattgatcaagtcatgagcaat
agatggattgctcaatacacagctgtgcctcaaacccccttgcatactcataaaatgcta
aaagaaggtgaagagatgtggcctgaagtacaggaggaaatgacgcgctcgttggccaca
atgagagtggattatgaccaagtgcatataaaaacgctagaaaattcaaataacccgctg
ctgaataaaaggcgtaagcgttcggcgaatcaagtgacgctaaaggagcagaaataa

DBGET integrated database retrieval system