KEGG   Tribolium castaneum (red flour beetle): 662445
Entry
662445            CDS       T01046                                 
Symbol
RpS18
Name
(RefSeq) ribosomal protein S18
  KO
K02964  small subunit ribosomal protein S18e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    662445 (RpS18)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    662445 (RpS18)
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Small subunit
    662445 (RpS18)
SSDB
Motif
Pfam: Ribosomal_S13 NFACT_N Period_C PGM_PMM_II
Other DBs
NCBI-GeneID: 662445
NCBI-ProteinID: XP_973632
UniProt: D6WLS9
Position
LG5:10168953..10169961
AA seq 152 aa
MSLVIPEKFQHILRILNTNIDGKRKVMFALTAIKGVGRRYSNIVLKKADVDLDKRAGECS
DEEVEKIVTIMSNPRQYKIPDWFLNRQKDIVDGKYNQLTSSTLDSKLREDLERMKKIRAH
RGMRHYWGLRVRGQHTKTTGRRGRTVGVSKKK
NT seq 459 nt   +upstreamnt  +downstreamnt
atgtctctagttattccggagaagtttcaacacattcttcgtattttaaatacgaacatt
gatggcaaacgcaaagtcatgtttgccctcacggccatcaaaggtgtcggccgaagatac
tcaaacattgtcttgaaaaaagccgacgttgacttggacaaacgcgctggtgagtgttcc
gacgaagaggtcgagaaaatcgtcacaattatgtcgaaccctcgccaatacaaaatccct
gattggttcctcaacaggcagaaggacattgttgatggtaaatacaaccagttgacttcg
tcaacgcttgactccaaattgcgtgaggatttggaacgcatgaagaaaatcagggcccac
aggggaatgcgtcattactggggcctcagggtccgcggtcaacacaccaagaccacgggt
cgtcgcggacgcactgtcggtgtctccaagaagaagtaa

DBGET integrated database retrieval system