KEGG   Tribolium castaneum (red flour beetle): 662488
Entry
662488            CDS       T01046                                 
Name
(RefSeq) protein transport protein Sec31A
  KO
K14005  protein transport protein SEC31
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    662488
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    662488
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:tca02044]
    662488
Membrane trafficking [BR:tca04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    662488
Secretion system [BR:tca02044]
 Sec (secretion) system
  Eukaryotic Sec-SRP protein
   662488
SSDB
Motif
Pfam: Sec16_C WD40 Prp18
Other DBs
NCBI-GeneID: 662488
NCBI-ProteinID: XP_015837847
Position
LG8:complement(4139139..4161166)
AA seq 1169 aa
MKVKDVERTANVAWSPKNQSPILLAAGTAAQQLDASFSTNATLEIYSLNLGELGPDMVLK
AATPSEHRFHKIIWGAYESHGTIVGGCDGGLIQIYSASKLMNGENGLICRQNKHTGPVHA
LDFNPFQQNLFATGAGDSEIFIWDLNNTNTPMSPGSKSQPLEDVLAISWNRQVQHILAST
FASKCVIWDLRKNEPIIKLTDTVSRVRWKMIAWHPEVATQLCLASEEDHSPIIQLWDLRF
ATSPLKTLENHQRGVLSVAWCADDPDLLVSCGKDNRIIAWNPNSNEPNGEVLSEIAKTNQ
WNFDVQWCPRNPAIIACPSFDGHVSVYSLMGGKTQQIQTTNKIADSFPGMDGYVQAPVLQ
QSSAPVSVDLSRPPKWLKRPVGARFGFGGKLISFDNTKPDVDQISHRTVQISQVITEPEL
VQKSTELEQALEYGNFTEYCSRKAETTNDQHTKYIWHFLRANFEENPRAELLNLLGYRIE
DVNNKLNQFVHKNKVDGVSERLEDLDPFDAIVDNKTVTKPFKIKTGDDTEGLITQALLLG
NVEAAVELCLEAKRFADAIIIAMTGGSDLLARTQHAYLEQCEGYVSSLISALVSEDWASV
INNCDLSSWKEALAATLTHSTDEALPLLCEQLGNRLSHGDAKLKQDSQLCYICAGSFDNL
VNSWSGNAQNSTSDLQDLVELVVFLQKAVERQGRQVQISGALADLLGRYASILASQGNLS
TALSYLGSSQDEKVAALRERLYISLGQKPGYGAQRQAQSRRLSQRQSFSSYPNMGAQFNS
GLPNAAVPVSQPWQPQPQMGGFNQQPPARTFSPAPPSQPTRPPSVGSNHGGSGTGLPSRK
YVLDPSVTSNPYGAPTRNMYAPQPVSNFQNNNYGAPSPITPLVPSNNNYVPNPVPMVPNP
PLNPTPLVPNIQPPPPMTSEMGQPATEKYFPSSAPGWNDPPPLNKPLRPQCYGDNVEMSA
VHAGTKLWKPKPKPEASVPSQPITHPLYGSAPTNNGYGTEPQMFQPQPTNNFAPPNNFTP
PTTFNPTGFKSNAVNFNQVQNQTPVVPEKPQPIQKPPIPEEHIHMQTVFDELKYQCSCAA
NNPQTKRKLEDVGRKLESLYDLLREQKLSPNTLGALHQMVQLVQNGDYTGGLNLHTQLVS
GPDFAQIASFMPGLKVLLQCALQLQVYLR
NT seq 3510 nt   +upstreamnt  +downstreamnt
atgaaagtgaaagacgtggagcgcaccgccaacgtagcgtggtcccccaagaatcagagc
cccattttgttagcagccgggacagccgcccaacagctcgacgcctccttcagcaccaat
gccaccttggagatctattccctcaacttgggggagttgggtcccgatatggtgctcaag
gctgcgaccccgagcgagcaccgctttcataaaatcatctggggggcttacgagagtcat
gggaccatcgtgggtgggtgtgatgggggcctgatccagatttacagcgcttccaagttg
atgaatggggagaatgggctgatttgtcggcagaataagcacacagggcctgtgcatgcg
cttgactttaacccctttcagcagaatttgttcgcaacgggggccggggattccgagatt
tttatctgggatttgaataacaccaacacgcccatgagtcctgggtccaagtcgcagccg
ctggaggacgttctggcgatttcgtggaataggcaagtgcagcatattttagcgtcgact
tttgcctccaagtgtgtcatttgggatttgaggaagaacgaaccgattattaaattaacg
gacactgtctcgagggttaggtggaaaatgattgcatggcatccggaagtggccacgcag
ttgtgtttagcttctgaggaggatcactctcccattatccaattatgggacctccgtttt
gccacatccccccttaaaacactcgagaatcaccaaagaggcgtattatcagtggcgtgg
tgtgccgatgatcccgatttattagtcagttgtggtaaagataatcgtattattgcctgg
aatccaaattcaaatgaaccaaacggagaggttctctccgaaattgcaaaaacgaatcaa
tggaattttgatgtacagtggtgtcctagaaatccagccattattgcatgtcccagtttt
gatggacatgtttctgtttattctttaatggggggcaagacccaacagatacaaaccacg
aataaaattgctgatagttttccgggaatggatggatatgttcaagctcctgttctacag
caaagctcggcaccagtcagtgtggatttaagtagaccaccaaagtggcttaagagacca
gttggagccagatttgggtttggtggcaaattaatttcgttcgataacactaaacccgac
gttgatcaaatcagccaccgaacggttcaaatcagtcaagttataaccgaaccagagcta
gtccagaaatcaaccgaactggaacaagctctcgaatacggcaacttcactgaatactgt
tcccgcaaagccgaaaccacaaacgatcaacacaccaaatacatttggcactttctgcgt
gccaacttcgaggaaaaccctcgcgcggaactattgaatttattgggctatcgcatcgaa
gacgtcaataacaaactcaaccaattcgtccacaaaaacaaagttgacggagtatcggaa
cgtttagaggacttggatccatttgacgcaattgtcgataataaaacagtgacaaaaccg
ttcaaaatcaaaactggtgacgacaccgaaggcttaatcactcaagcgctgcttttgggg
aacgtcgaagcggcggttgagttgtgtttggaggcgaagcgcttcgccgacgctatcatt
attgcaatgactgggggctcggatttattggctcggacccaacacgcgtacttggagcaa
tgcgagggctatgtttcgtcgctgatttcggctttggtgtccgaagactgggcttctgtt
atcaataactgcgacctgagcagttggaaggaggcacttgcggccactctgacgcactcc
accgacgaggcgttgccccttctgtgcgaacagctcggaaatcgcctcagccacggcgac
gccaaactcaaacaagactcccagctgtgctacatctgcgctgggagtttcgacaatctg
gtcaactcctggagcggcaatgcgcagaattccaccagcgatttgcaggatttggtcgag
ttggtggtgtttttgcaaaaggcggtggaaaggcaagggcggcaggtgcagatttcgggc
gctttggccgatttgctgggcaggtatgcgtcgattttggcctcgcaggggaatttgtcg
acggcgttgagttacttggggagttcgcaagacgagaaggttgcggcgttgagggagcgc
ttgtatatcagtttggggcagaagccggggtatggggcgcagagacaggcacagagtcgg
aggttgagtcagagacagtcgttttcgagttatccgaacatgggggcacagtttaattca
ggactgccgaatgcagcggttccggtgtctcagccgtggcaaccgcagccccaaatgggg
ggttttaatcaacaaccaccggcgaggacgttttcgccggcgccgccgagtcagccgacg
aggcccccaagtgtgggatctaaccatggtggttctggcacgggcttgccttcgcgtaaa
tacgttctggacccctctgtaacctccaacccctacggagcgcctacgaggaacatgtac
gccccccaacctgtctccaacttccagaacaataactatggggccccatcaccaataaca
cccttggttccttccaataataattacgtacccaatcctgtaccaatggtacccaatcca
ccactcaatcccactcctttggtaccaaatatccaaccaccgccgcctatgacgagcgag
atgggccaacctgccacagaaaaatactttccttctagtgcccccggctggaacgatcca
cctccactaaacaaaccattgagaccacagtgttacggtgataatgttgaaatgtcagca
gtgcatgctgggacgaaattatggaaaccaaagcccaaaccagaggcatccgtcccatct
caacccataacgcacccattgtatgggtcggcgcccaccaacaacggttacggaaccgaa
ccacaaatgttccaaccacagccaactaataattttgccccacctaacaatttcacaccg
cctactacgttcaatccgactggttttaagtcaaatgcggtcaattttaaccaggtccaa
aaccaaactcctgtggttccagagaaaccacaaccaattcaaaaaccaccaattcccgaa
gaacacatacacatgcaaaccgtttttgacgagttgaaatatcagtgcagttgtgcggct
aataatccgcaaaccaagcgaaaattggaggatgttggccgaaagttagagtcgttgtat
gatttgttaagggaacagaaactgtcacccaacactttaggagcgttacatcaaatggta
cagttggtgcaaaacggagattatacaggaggactgaatttacacactcagctagtgtca
gggcctgatttcgctcaaattgccagttttatgcccgggcttaaagttttgttacagtgc
gctttacaattgcaagtttatttaagataa

DBGET integrated database retrieval system