KEGG   Tribolium castaneum (red flour beetle): 662504
Entry
662504            CDS       T01046                                 
Symbol
Pmp5-a
Name
(RefSeq) peritrophic matrix protein 5-A
  KO
K01873  valyl-tRNA synthetase [EC:6.1.1.9]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    662504 (Pmp5-a)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tca01007]
    662504 (Pmp5-a)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tca03016]
    662504 (Pmp5-a)
Enzymes [BR:tca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.9  valine---tRNA ligase
     662504 (Pmp5-a)
Amino acid related enzymes [BR:tca01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   662504 (Pmp5-a)
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    662504 (Pmp5-a)
 Prokaryotic type
    662504 (Pmp5-a)
SSDB
Motif
Pfam: CBM_14
Other DBs
NCBI-GeneID: 662504
NCBI-ProteinID: NP_001280544
UniProt: D1MAJ5
Position
LG3:628744..630118
AA seq 372 aa
MNAFTLLVLFAVSAFAEKLESDPLCAGVPPGSTYLFPYPGDCTKFYVCENGTKRVEDCPS
GLWFNEALQACDHPDNSGCHPIVCPPSIVDFYPYPEDCTKYIECYHGNPETHTCPDNLWF
NSVEKRCTDPSSSGCGEHSSSVEPTWSTPNPICWGVLPGQTVLRPYPGDCNKFYECYGSR
QTEMNCPPHLYFNEARQMCDWPDVSGCDDTTETPNPNPTSTITPPTTPSGNDDPRCANGN
NDYWPDPDCTKFVECYHGHGYIMDCPSGLYFDSVDKKCEDPSEADCGRTTPTPDPWTTTK
SSDWTNDPDCPFPSADRYLFPYPGDCTKFLECWNGEKVAQECPAGLWFNPNLLVCDYPYH
SGCKYGEEEQEV
NT seq 1119 nt   +upstreamnt  +downstreamnt
atgaacgctttcacacttttggtactttttgccgtttcggcatttgccgaaaaacttgaa
tctgatccactttgtgccggtgttccccctggctcaacttaccttttcccctatcctgga
gattgcacaaagttctacgtttgcgaaaacggcaccaaacgagttgaagattgtccaagt
gggttatggtttaatgaggcattacaagcctgcgatcatcctgataattccggatgccat
cctatcgtgtgccctcctagcattgttgacttctacccttatccagaggactgtaccaag
tatattgagtgctaccacggaaatccagaaacacacacttgtccagataatctctggttc
aacagtgtggaaaaacggtgcactgacccttccagctcgggctgtggggagcattcctcc
tcggtggagcccacctggagcacacccaaccccatttgttggggggtactcccaggacaa
acagttctaagaccatatccaggggattgtaacaagttttacgaatgctacggttccaga
caaactgaaatgaactgtccgcctcatctgtatttcaatgaagcgagacagatgtgtgat
tggccggatgtttccggatgcgatgataccactgaaaccccgaatcccaatcccacttcc
accatcacacccccaacgaccccaagcgggaacgacgacccgcgctgtgctaatggtaac
aatgactattggccagacccagattgtaccaaattcgtggagtgttaccatgggcatggg
tacatcatggattgcccatctgggctctatttcgattcagttgataagaaatgtgaagat
ccaagtgaagctgattgcggtcgtacaacaccaacgcctgacccatggacgaccacgaaa
tcgtccgattggaccaatgatcccgattgtccatttccaagtgccgataggtacttgttc
ccatatccgggagattgtaccaaatttctggaatgttggaatggggaaaaagtggcacag
gagtgtcccgctggactttggtttaacccaaatttgttggtttgtgattatccctaccat
tctgggtgcaaatatggggaagaggaacaagaagtttga

DBGET integrated database retrieval system