KEGG   Tribolium castaneum (red flour beetle): 662544
Entry
662544            CDS       T01046                                 
Name
(RefSeq) dnaJ homolog subfamily B member 11
  KO
K09517  DnaJ homolog subfamily B member 11
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    662544
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:tca03110]
    662544
Chaperones and folding catalysts [BR:tca03110]
 Heat shock proteins
  HSP40 / DNAJ
   662544
SSDB
Motif
Pfam: DnaJ_C DnaJ
Other DBs
NCBI-GeneID: 662544
NCBI-ProteinID: XP_973727
UniProt: D6WL83
Position
LG5:complement(8943791..8945276)
AA seq 357 aa
MNVNSVPVLLLLTFISVTSVLAGRDFYKILGVSKSASLHEIKKAYRRLAKELHPDKNQED
PEASQKFQDLGAAYEVLSDEEKRKKYDRCGEDCLQKDGMMDSGMDPFASFFGDFGFPFGG
GEQKHETPRGADVVMDIAVTLEDLYSGTFIEITRNKPVMRAAKGTRKCNCRQEMITRNLG
PGRFQMMQQTVCDECPNVKLVNEERVLEMEVEPGMVDGQETKFTAEGEPHLDGDPGDLIL
KIKTQPHPVFERRGDDLYTNITISLQDALVGFTMELQHLDGHMVSISRDKITWPNARIRK
KGEGMPNYDNNNLHGNLFITFDVEFPKQELSDDDKEAIKKILNQSSRNKVYNGLRGF
NT seq 1074 nt   +upstreamnt  +downstreamnt
atgaacgtgaactctgtgcccgtcttgcttttactgactttcatttcggtaacctcagtt
ctagcagggcgagacttttacaaaatactgggtgtctcaaaaagcgccagtttgcacgaa
atcaaaaaggcctatcgtcgcctagccaaagagctgcaccctgacaagaaccaggaagat
ccggaagcctcccaaaaattccaggacctgggggccgcctacgaagtcctctcagacgag
gaaaaacgcaagaagtatgatagatgcggggaggactgtctccagaaagacgggatgatg
gacagtgggatggaccccttcgccagcttcttcggcgacttcgggttccccttcgggggc
ggcgaacagaagcacgagactccgagaggcgctgacgtggtgatggacatcgccgtgacc
ttggaggatttatattcgggcacttttatcgaaattacgcggaataagccggtgatgagg
gcggccaaaggcaccaggaagtgcaactgccggcaagagatgatcacgcggaatctgggg
cccgggaggttccagatgatgcagcagacggtgtgcgacgagtgtccgaacgttaagcta
gtcaatgaggagcgcgttttggagatggaagtggagccggggatggttgatgggcaagaa
acgaagtttacggctgagggggagccccatttagatggggaccctggcgatttgatactt
aagataaagacgcagccgcatcccgtttttgagcgcagaggggacgatctgtacactaac
atcacgattagtttacaagacgcccttgtggggttcactatggaactccagcatctggat
ggtcacatggtttcgataagtagggacaaaatcacttggcccaatgccaggataaggaag
aaaggagaaggcatgccaaactatgataataataacttgcatgggaatttatttattaca
tttgatgtagagttccccaaacaagaattatcagatgatgacaaagaagctatcaagaaa
attctaaatcagagctcaagaaacaaagtttataatggactaagagggttttaa

DBGET integrated database retrieval system