KEGG   Tribolium castaneum (red flour beetle): 662564
Entry
662564            CDS       T01046                                 
Symbol
ald
Name
(RefSeq) altered disjunction
  KO
K08866  serine/threonine-protein kinase TTK/MPS1 [EC:2.7.12.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:tca01001]
    662564 (ald)
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:tca03036]
    662564 (ald)
Enzymes [BR:tca01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     662564 (ald)
Protein kinases [BR:tca01001]
 Serine/threonine kinases: Other
  TTK family
   662564 (ald)
Chromosome and associated proteins [BR:tca03036]
 Eukaryotic type
  Centromeric chromatin formation proteins
   SAC (spindle assembly checkpoint) factors
    Protein kinases
     662564 (ald)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Kinase-like ABC1 RIO1 TCAD9
Other DBs
NCBI-GeneID: 662564
NCBI-ProteinID: XP_973747
UniProt: D6WZP1
Position
LG9:complement(13403233..13406251)
AA seq 429 aa
MSSLTSEFSSVRKPKREGNLTEPPFSLSTIKGRSCQRLKFMSIKPLRLDEIQKEIEEAEN
SAERANVYCPPSKEPRGCAPLQDSFDLNFSPLATPSKEPPCDKFVTPDNRIPAKVQCSVR
VKPALPGLSAGSPEVSFRRIRVNEVGYVVLNELGKGGSSQVFHCFNPETKQHRAIKVVSL
ENKVSAVGFINEVKMLQTLQKCNRIIKMFDYEIKEEEKKLLVVLEVGGTDLSKILKESAL
NNAHMPLYMLLYYWMEMLYAVRQIHESGIVHSDLKPANFLEVEGYLKLIDFGISSCIQSD
MTSVIKAVPEGSFNYISPEALSSETSSNASSPSFGKPKYKISYKSDVWSLGCILYQLVYR
RTPFQHITQIWVKLSAIVNPDHKIDYPDAHWVPQKLINTIKKCLQRNAKARPSIDELITD
YENMFHSLV
NT seq 1290 nt   +upstreamnt  +downstreamnt
atgagttctctgactagtgagttttcttcagtgcggaagccgaaacgggagggcaattta
acggagccgccgttcagcctcagtacgatcaaagggcggtcatgccagcgcctcaagttc
atgtcaataaagccgctgcggcttgacgagatccagaaagagatcgaagaggcggaaaac
agcgccgaacgcgccaatgtgtactgcccccccagcaaggaaccccggggttgcgccccc
ttgcaggacagcttcgacctgaacttctccccgctggccaccccgtccaaggagcccccg
tgtgacaagttcgtgacccccgataacaggatcccggccaaggtgcaatgcagtgtgagg
gtgaagcccgcactgcccggtctgagcgccggctctccggaggtctcgtttcggagaatt
cgggtcaatgaggtggggtatgtggtgctgaatgagttggggaaagggggcagttcgcag
gtttttcactgttttaaccccgagactaagcaacatcgggcgattaaagtcgtttcactg
gagaataaggtctcggctgtggggttcatcaacgaggtgaagatgctgcagacgttgcaa
aagtgcaatcgcatcattaagatgttcgattatgagattaaggaggaagagaagaagttg
ttggtggtgttggaggttggagggactgatctgtcgaagattttgaaagagtcggcgctc
aacaacgcccatatgcccctctacatgctgctctactactggatggagatgttgtacgcc
gttaggcaaattcatgaaagcggaatcgttcattcggatttgaagccagcgaattttctc
gaagtggaaggttatttgaaactgatcgatttcggaatctccagttgcattcagagcgat
atgacgagtgtcataaaggcggtgcctgagggctccttcaattacataagtcccgaagcg
ctaagcagtgagactagttcgaatgccagcagcccctcgttcggaaaaccaaagtacaaa
attagttataagtctgatgtttggtcgctgggttgcatcttataccagctggtctaccgc
cgcacccccttccagcacatcacccagatctgggtgaaactttcggcaatcgtgaacccg
gaccacaaaatcgactacccggacgcccactgggtgccccaaaaactgataaataccata
aaaaagtgccttcaacgtaacgcaaaagccaggccctcgatcgacgaactaatcaccgac
tacgaaaacatgttccatagtttagtgtaa

DBGET integrated database retrieval system