KEGG   Tribolium castaneum (red flour beetle): 662858
Entry
662858            CDS       T01046                                 

Definition
(RefSeq) cytochrome c oxidase subunit 6A2, mitochondrial
  KO
K02266  cytochrome c oxidase subunit 6a
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
Module
tca_M00154  Cytochrome c oxidase
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    662858
SSDB
Motif
Pfam: COX6A DUF364
Other DBs
NCBI-GeneID: 662858
NCBI-ProteinID: XP_974027
UniProt: D6WXC3
Position
LG8
AA seq 112 aa
MAALINHSVRRFLQTSARRAVQVQGPSAVSGGHEGGYKVWRNMTFFVAFPAIALCAVNCY
LAHYSGHHERPPFVKYEYLRIRTKRFPWGDGNHSLFHNPHTNALPDGYEDEH
NT seq 339 nt   +upstreamnt  +downstreamnt
atggcggctcttatcaaccactctgttcgaagatttttgcaaacttctgcccgaagggcc
gttcaggtccaggggccttcggccgtttccggtggccatgaagggggctacaaggtctgg
aggaatatgacgttctttgtggcatttccagccatcgctctgtgcgctgtgaactgctac
ctggcccactacagtgggcaccatgagaggccacctttcgtcaagtacgagtatttgagg
atcaggactaagaggttcccgtggggcgatggcaaccactccttgttccacaacccacac
actaatgctctccctgatggttacgaggatgaacattag

DBGET integrated database retrieval system