KEGG   Tribolium castaneum (red flour beetle): 663029
Entry
663029            CDS       T01046                                 

Definition
(RefSeq) uncharacterized LOC663029
  KO
K03662  V-type H+-transporting ATPase S1 subunit
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00190  Oxidative phosphorylation
tca01100  Metabolic pathways
tca04142  Lysosome
tca04145  Phagosome
Module
tca_M00160  V-type ATPase, eukaryotes
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    663029
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    663029
   04142 Lysosome
    663029
SSDB
Motif
Pfam: ATP-synt_S1
Other DBs
NCBI-GeneID: 663029
NCBI-ProteinID: XP_974187
Position
LGX
AA seq 411 aa
MALYCNILIFVITVLGINVVRSAEFVPVYMWGTTKLSERVPALHKISQDSFKDTLLEYLK
EDPYIIVFVEPTLSPEDFAQHDQNGDIAFPNLHGLKKLKNHVAYKPYVQNPVRAVKQLNK
EVTELSIASLLSSSNVPKDNILIIDLNDAKDDEPRFHMLKRHDSDIVSIYKDILEQRNNV
LAIYTANHTSWIAPEDITHSRSRSLLQSEDTEEKDTGHLYTSEHVLLYLSKDGMYQVDKE
SSGILIDDSFTLHEETTSKDNKENITAILSSGKSDLSVNFDIKFNNVSGYWYLTSMSVKK
GGKEDPIVGISDYFAPRGFSYHCSTFNLSTTDKNATLSLPGFQIQPFPKNNTFGDAYDCV
GFTSVPIWSGLFITIILLLIVTFGLTMMMDIKTMDRFDDPKGKTITITASE
NT seq 1236 nt   +upstreamnt  +downstreamnt
atggctctttattgtaacattttaatatttgtaataacagtattaggcataaatgttgtc
agaagtgcagaatttgtacctgtttacatgtgggggactacgaagttgtcagaacgagta
cctgctttgcacaaaatcagtcaagattcgtttaaagacacccttttagagtatctgaag
gaggacccttacataattgtgtttgtagaacccactttgagtcctgaagattttgctcaa
catgaccaaaacggggatatcgcgttcccgaatctccacggtttgaagaaacttaaaaat
cacgttgcttacaaaccctatgtacaaaatccagttagagccgtcaaacagctcaataag
gaagtcacagagttgtccattgcatctctgttgagtagctctaatgtgcctaaagataat
attttgattattgatttgaacgatgccaaagatgatgaaccccggtttcatatgctgaaa
cgtcacgattctgacattgtgtcaatttataaggatatcctagaacaacgcaataatgtc
ttggctatatatacggcgaatcacacgtcttggatagcgcccgaggatattacccactcc
agatccagaagcttgctccagtcagaagatacagaagagaaagacactggacacttatat
acctccgaacacgttttgttatatttgagcaaagatggaatgtatcaggtggataaggag
tcgtctggaatcctaattgatgactcttttacactacatgaagaaaccaccagcaaagat
aacaaagagaatataacagcgattttaagcagcggcaagagtgacttgtctgttaatttt
gatatcaaatttaataacgtgtctggatactggtatttaacttcaatgagcgtaaagaaa
ggtggtaaagaggacccaatagttggtattagtgattacttcgcgcctcgcggtttttcc
taccactgttctacttttaatttatcaacgacggacaaaaacgcaacgttgtctctgccc
ggatttcagatccagccgttccccaaaaacaacacatttggggacgcctatgactgcgtt
ggattcacatcagttcctatctggtcgggtttgtttataacaataatcctgttgttgatc
gtcacctttggtcttaccatgatgatggatattaagactatggaccgattcgatgacccc
aaaggcaaaacgatcactatcactgcttctgaataa

DBGET integrated database retrieval system