KEGG   Tribolium castaneum (red flour beetle): 663238
Entry
663238            CDS       T01046                                 

Symbol
serpin7, serpin8
Name
(RefSeq) serpin peptidase inhibitor 7
Organism
tca  Tribolium castaneum (red flour beetle)
SSDB
Motif
Pfam: Serpin PhyH
Other DBs
NCBI-GeneID: 663238
NCBI-ProteinID: XP_974388
UniProt: D6WWI0
Position
LG8
AA seq 395 aa
MKTLTAFAAVICISLADDTALKEFTSGNNLFTTSIYKEIKKTTPGNFLVSPFSAESVLAL
VQGGAKDATALEMRDALHLPAAPETTQAAIKALHPQLKQTLYTLKTANKIYLKPGFEVRP
EFRKVASEVFEAGLENIDFERKEEAAQAMNQWVEEQTEHKIQNLISPENLNSRTRSILIN
ALYFKGNWSSPFKKFLTKEEDFYKNGKQVAPVATMKLQSSTKYYESEELKAKFLELPFEG
GDVSMIIVLPNEKDGLEVLENQLEKTVELPQLAEEYVKVALPKFQIRSQFILKEMLQELG
MKKAFKGEEADLSGIAGDKGDLVIDQVVQKTFIDLNEDGVEAAAATFVGVGIPLSGVVST
VTPKEFKADHPFLFYIKFKDLILFAGRVVDPTDSK
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgaagactctcacagccttcgccgcagtaatttgcatctccttggccgacgacacggcc
ttgaaagaattcacttcaggcaataatttgtttaccacatcaatttacaaagaaatcaaa
aaaacaacacctggcaatttcctcgtgagccccttttcggccgagtcggtcctggccctg
gtccaagggggcgccaaggacgcaaccgccctggaaatgcgcgacgccctccacctgccc
gccgcccccgaaacgacccaagccgccatcaaagcactccacccccaactcaagcaaacc
ctctacaccctcaaaaccgccaacaagatctacctcaaaccagggtttgaggtgcggccc
gagttccggaaagtggcaagtgaggtttttgaggccggcttggagaacatcgattttgag
aggaaagaggaagctgcccaggccatgaaccaatgggtggaggaacaaactgaacacaag
atccagaatttgatcagtccggagaatctcaattccaggacgcgctcaattttgatcaat
gccttgtatttcaagggcaattggagctctccgtttaagaaatttttaacgaaagaggag
gatttttacaagaatggcaaacaagtggctcctgttgccacaatgaagctgcagtcgtcg
acaaaatactacgagagtgaggaacttaaggccaagtttttggagctgccgttcgaaggg
ggtgatgtgtcgatgattattgtgcttccgaatgagaaagacgggcttgaggttttggaa
aatcagttagagaaaaccgttgagttgccacaactggcggaagagtacgtgaaagtggcg
ctcccgaaattccaaatccggagccaattcattttgaaggaaatgctacaagagctgggg
atgaagaaagccttcaagggcgaggaggccgacttgagtggcattgcaggtgacaaaggc
gatctcgtaattgaccaagtcgtccaaaaaactttcattgatttgaacgaggatggagtt
gaggcagcggctgctactttcgttggagttggaattcctttaagtggagttgtttcaact
gtcactccgaaagaattcaaagccgaccatccgttcctgttctacatcaaattcaaagac
ttgatcctgttcgctggacgggtcgtggatccgaccgattcgaaataa

DBGET integrated database retrieval system