KEGG   Tribolium castaneum (red flour beetle): 663527
Entry
663527            CDS       T01046                                 
Name
(RefSeq) phosphoglycolate phosphatase
  KO
K19269  phosphoglycolate phosphatase [EC:3.1.3.18 3.1.3.48]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00630  Glyoxylate and dicarboxylate metabolism
tca01100  Metabolic pathways
tca01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    663527
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:tca01009]
    663527
Enzymes [BR:tca01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.18  phosphoglycolate phosphatase
     663527
    3.1.3.48  protein-tyrosine-phosphatase
     663527
Protein phosphatases and associated proteins [BR:tca01009]
 HAD phosphatases
  Other HAD phosphatases
   663527
SSDB
Motif
Pfam: Hydrolase_6 Hydrolase_like Hydrolase HAD_2 PGP_phosphatase
Other DBs
NCBI-GeneID: 663527
NCBI-ProteinID: XP_974660
UniProt: D2A390
Position
LG4:complement(3021253..3022643)
AA seq 305 aa
MSVIFLSKQTKEEFKKFFSSFDTVLFDCDGVLWLDNEPISGSVPVVNRLRELGKRIFFVT
NNSTKMRNEFAVKAKRMNFNIETDEIISTAYLAAAYLKNMDFKQSVYVVGSRGITQELDA
VGIKHYGVGPDVLQNALVHVIENFQMESDVGAVIVGYDEHFSYVKMMKAASYLNNPNCLF
IATNTDERFPMSTDLVIPGTGAIVSAVETCAQRSPIVVGKPNPYIVDDLIKKYGIVPKRT
LMIGDRVNTDILLGTRCGFQTLLVLSGVTTLKEAVALKNSHKKEDKEMVADFYLEKLGDI
LPLLD
NT seq 918 nt   +upstreamnt  +downstreamnt
atgtctgtgatttttctttcaaagcaaaccaaagaggagtttaagaagtttttcagttct
ttcgacactgttcttttcgactgtgatggggttttatggcttgacaatgaaccgatttct
ggttcagtcccggttgtgaacagactccgcgaattgggtaaaagaatattcttcgttaca
aacaactcgacaaaaatgcgaaatgaatttgccgttaaggcgaaacgtatgaattttaac
attgaaacggacgaaattatatcaacggcatacttggcagcggcctatttgaaaaacatg
gattttaaacaatccgtttacgtggtgggctctcggggaatcacccaagagctggacgct
gtcggtatcaagcattacggagttgggccagacgttttgcaaaacgctctggtccatgtc
atcgagaatttccaaatggaaagtgacgtaggcgccgttatcgtcggctatgacgagcac
ttctcatacgtgaaaatgatgaaagcggcctcttatctaaacaatcctaactgccttttt
attgccactaacacagacgagcgatttccgatgagtacggacttagtaatcccaggaact
ggggccattgtctcagctgtggagacctgcgcccagcgcagccccattgtcgtgggcaag
cccaacccatacattgtggatgacctcataaaaaaatacggaattgtgcccaaaagaaca
ctcatgataggcgatcgcgtcaacaccgatattttgctgggaacgcggtgcggctttcaa
accttgttggtgctatctggagttacgacgctcaaagaagcagtcgctttgaaaaattcg
cacaaaaaggaggacaaggaaatggtcgctgatttttacctggagaagctgggagatata
ctgccacttttagattga

DBGET integrated database retrieval system