KEGG   Tribolium castaneum (red flour beetle): 663535
Entry
663535            CDS       T01046                                 
Name
(RefSeq) UBX domain-containing protein 6
  KO
K14011  UBX domain-containing protein 6
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04141  Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    663535
SSDB
Motif
Pfam: PUB UBX RIX1
Other DBs
NCBI-GeneID: 663535
NCBI-ProteinID: XP_008195213
UniProt: D6WRT9
Position
LG7:348478..350637
AA seq 438 aa
MADKIKKFFAKKKADAKFKLAGPGHRLNESSTAIVGPSKQKPAYVPQRSQPSDATRQAAD
AALARLQNQSRNPNFNTSLAAIQAQVRRELEAEKKSTEPVAPSAPVQTNLETSPHLAVKG
VYFRCPLISEEVLTKDEWKVKIKEFLFEQLEEERGLTACLIIQSCNYNRNKVKECVDVLV
RYLDNIIANPQEPKFHKIRCSNATFRDKVLPVLGATDFLLAAGFQQQVLSHNGSDEEFWV
FDEQNIESLQVLELLREALKCEDRVELELDRNIQVLSPAQAAQRIDLPQEFYALSPEEVK
REQQLRTEAMEKQMQLRTKAMREKEELREIRKYKFALIRIRFPDGLYLQGTFSVYEKFSE
VLDFVQDNLEHSGLPFVLTSPTGHKFEESDNEISLAQLKLVPATILTFQWDASVADEFAR
AGNTSYLKPEVMMLMQQL
NT seq 1317 nt   +upstreamnt  +downstreamnt
atggcggacaaaataaaaaaattcttcgcgaaaaaaaaggccgatgccaagtttaagttg
gcagggccggggcatcgtttgaatgagtcctccactgcaatagtggggcccagcaagcaa
aaaccagcctatgtgccccaaaggtcacagcctagcgatgccacaaggcaagcagctgat
gcggctttagctaggctccaaaatcagagtagaaatccgaattttaacacgtcattagct
gcaattcaggcccaagtcaggcgggaattagaagctgagaagaaaagtacagaaccggtg
gcaccatcggctcctgttcaaactaatctggagacttcgccccatcttgcagtcaaaggg
gtttattttcgatgccccttaattagcgaagaagtgctcaccaaagatgaatggaaggtg
aaaatcaaagaatttttgtttgaacaactggaagaagagagaggtttaacagcctgcctt
attatccagtcttgcaattacaatagaaataaagtgaaagaatgtgttgatgtattagtc
cgctatctagacaatatcatcgccaatcctcaggaaccaaagtttcataaaattcggtgt
tcaaatgcaacattccgagataaagttttgccggttttgggagcgactgattttttgtta
gctgctgggttccaacagcaagttctgagtcacaacggcagtgatgaagaattttgggtg
tttgatgagcaaaatatcgaaagtcttcaagttctagagcttcttcgcgaagcattaaaa
tgcgaagatagagtggagttagaattagatcgtaatattcaagtgttgtcaccagcgcaa
gctgcccaaaggatagacttgccccaagaattttacgccctaagtcctgaagaagtcaag
agggagcaacaattaaggacagaagcaatggaaaagcagatgcaactaaggaccaaagca
atgcgtgagaaagaggaacttcgcgaaatacgcaaatataaattcgctttgatacgaatt
cgattcccagatggtctctatttgcaaggaactttttcagtttatgaaaaattctccgaa
gtgcttgattttgttcaagacaatttggaacattcgggtttaccgtttgttctcacgtcg
ccaaccggccacaaattcgaagaatcagataatgagatttctttagcacagttgaagttg
gttccagcgacgattttgacgtttcaatgggatgcttcagtggctgatgaatttgcaagg
gcaggaaatacaagttatctcaaacccgaagtcatgatgttgatgcaacagctgtag

DBGET integrated database retrieval system