KEGG   Tribolium castaneum (red flour beetle): 663552
Entry
663552            CDS       T01046                                 

Gene name
Wnt5
Definition
(RefSeq) protein Wnt-5b
  KO
K00444  wingless-type MMTV integration site family, member 5
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04150  mTOR signaling pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    663552 (Wnt5)
   04150 mTOR signaling pathway
    663552 (Wnt5)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   00536 Glycosaminoglycan binding proteins [BR:tca00536]
    663552 (Wnt5)
Glycosaminoglycan binding proteins [BR:tca00536]
 Heparan sulfate / Heparin
  Morphogens
   663552 (Wnt5)
SSDB
Motif
Pfam: wnt
Other DBs
NCBI-GeneID: 663552
NCBI-ProteinID: XP_974684
BEETLEBASE: TC009318
UniProt: D6WRU0
Position
LG7
AA seq 373 aa
MRLTELSGRKSSAMQFFYYIVLSIFSINSTGAARRSPINGTWIRMGMMMDEKMQGDQGPP
TCHTLPGLSPGQIRLCQLYMDHMNAVALGARQALSECKHQFENRRWNCSLLNDVNVFGPV
ITIASRESAFAHALASAGVSYAVSRACRDGQLASCGCSRMGRPKDLRKDWVWGGCGDNLE
YGYKFTQNFVDVREKERKFKRGSKEQGRNLMNLHNNEAGRRAVIKKSKVTCKCHGVSGSC
SLITCWQQLATFREIGDYLRDKYDGATEVRINRRGRLQLRDTRFRVPTAYDLVYMEDSPN
YCIRDERVGSLGTQGRTCNRTSQDLDGCNLLCCGRGYNTLKSTIKERCHCKFKWCCEVEC
KTCVRSVDVHTCK
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgcgtctcacggagttgtccgggagaaaatctagtgcaatgcagtttttctattacatc
gtgctgagcatcttctccataaattcaacgggagcagcacggaggtcgccgataaacggc
acatggatacgaatgggcatgatgatggatgaaaaaatgcaaggtgatcaaggaccacca
acatgccacacacttccgggtttgagtcccggacaaatccggctctgtcaattgtacatg
gaccatatgaatgctgtggcattgggggctcgtcaggcgctatccgagtgtaaacatcag
tttgaaaatcgcaggtggaactgttctttactgaatgacgtcaatgtctttggtccagtt
ataacaatcgctagccgcgaatcagcatttgcacacgctctagcttcagccggagtgtct
tacgccgtttcaagagcttgcagagatggtcaacttgcatcttgtggatgctcaagaatg
ggacgaccaaaggatttacgaaaagattgggtatggggcggatgtggcgacaatttagag
tatggatacaaattcacacaaaactttgtagacgttcgggaaaaggaacgcaaatttaag
agaggatccaaggagcaaggacgcaaccttatgaacttgcacaacaacgaggctgggaga
agagcagtcatcaagaagtcgaaagttacttgtaaatgtcacggagtgtcaggttcttgt
tctttgataacttgctggcagcaactcgccacgtttcgagaaatcggcgattatttgcgt
gataaatacgacggagctaccgaggtgcgcatcaaccgtcgtggacgtctccaactccgc
gacacgcgttttcgagtgcccaccgcctacgacctcgtctacatggaggattcccccaac
tattgcatccgcgacgaacgcgtgggttccttagggacgcagggccgtacttgcaacagg
acatcacaggacctcgacggttgcaaccttttgtgctgcggtcgcggctacaacaccctc
aaatcaacgatcaaggaacgctgccactgtaagttcaagtggtgctgtgaagtcgagtgc
aagacgtgtgtgcgatcagtggacgtgcacacgtgcaagtga

DBGET integrated database retrieval system