KEGG   Tribolium castaneum (red flour beetle): 663575
Entry
663575            CDS       T01046                                 
Name
(RefSeq) 2-oxoisovalerate dehydrogenase subunit beta, mitochondrial
  KO
K00167  2-oxoisovalerate dehydrogenase E1 component beta subunit [EC:1.2.4.4]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00280  Valine, leucine and isoleucine degradation
tca00640  Propanoate metabolism
tca01100  Metabolic pathways
Module
tca_M00036  Leucine degradation, leucine => acetoacetate + acetyl-CoA
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    663575
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    663575
Enzymes [BR:tca01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.4  With a disulfide as acceptor
    1.2.4.4  3-methyl-2-oxobutanoate dehydrogenase (2-methylpropanoyl-transferring)
     663575
SSDB
Motif
Pfam: Transket_pyr Transketolase_C
Other DBs
NCBI-GeneID: 663575
NCBI-ProteinID: XP_015840467
Position
LG2:complement(7040343..7045759)
AA seq 322 aa
MNMFQAINNALDLALKQDESALIFGEDVAFGGVFRCTMGLQSKYGPGRVFNTPLCEQGIV
GFAIGAANMGSTAIAEIQFADYTFPAFDQLVNEAAKMRYRSGGQYDCGKLTVRAPCGAVG
HGGLYHSQSPEAYFAHTPGLKVVIPRGPIKAKGLLSACIRDPDPCIIFEPKTLYRAAVEE
VPVDDYVLPIGRADVLLEGNNVTLIGWGTQVHVLLEVAQLAKKQLNVSCEVIDLVSILPW
DKSTVCQSVKKTKRVLVAHEAPLTGGFGAELAATIQEECFLHLEAPVVRVTGFDTPFPHV
FEPFYLPDKWRCLEAIRNMLEY
NT seq 969 nt   +upstreamnt  +downstreamnt
atgaacatgttccaagcgatcaacaacgccctagacctggcgttgaaacaggacgaatca
gccttaattttcggcgaggacgtcgcctttggcggtgtgttccgctgcacgatgggcttg
cagtcaaagtacggtcctggtcgcgtattcaacacccccctgtgtgaacagggaattgtt
ggttttgcgatcggtgcagccaacatgggttcaacagcaatagcagaaattcaattcgcc
gattacacatttccggcattcgatcagctggtgaatgaagctgcgaaaatgaggtacagg
agtggggggcaatatgattgcggaaaattaactgtcagggcgccctgcggagccgtagga
catggagggctttaccattcacaaagtcctgaggcgtatttcgctcatactccaggatta
aaggtcgtcataccacgcgggccaataaaagccaaaggcctgctctcggcctgcatccga
gacccggatccttgcattatcttcgagcctaagaccctatatagggcagctgtggaagaa
gtgcctgtcgacgattacgttctcccgataggaagagcagacgttttgctcgaaggcaat
aatgtgaccttaataggatggggcactcaggttcacgtgctgctcgaggtggctcaattg
gccaagaagcaattgaacgtttcctgtgaagtgatcgacttggtttcgattttgccgtgg
gataaaagcactgtctgtcagtctgtcaagaaaaccaagcgagttttagtcgcccacgaa
gcaccgctaaccggaggattcggggcggaattggctgcaacaattcaagaggagtgtttc
ctgcatcttgaggcacctgttgtgcgagtcacgggcttcgacacgccgttccctcacgtt
ttcgagcccttctatctgccagacaagtggagatgtttggaggcgatacgtaacatgtta
gaatattga

DBGET integrated database retrieval system