KEGG   Tribolium castaneum (red flour beetle): 663582
Entry
663582            CDS       T01046                                 
Name
(RefSeq) histidine--tRNA ligase, cytoplasmic
  KO
K01892  histidyl-tRNA synthetase [EC:6.1.1.21]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00970  Aminoacyl-tRNA biosynthesis
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    663582
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:tca01007]
    663582
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:tca03016]
    663582
Enzymes [BR:tca01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.21  histidine---tRNA ligase
     663582
Amino acid related enzymes [BR:tca01007]
 Aminoacyl-tRNA synthetase
  Class II (A)
   663582
Transfer RNA biogenesis [BR:tca03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Other AARSs
    663582
 Prokaryotic type
    663582
SSDB
Motif
Pfam: tRNA-synt_His HGTP_anticodon WHEP-TRS tRNA-synt_2b tRNA-synt_2 tRNA-synt_2d Virul_Fac
Other DBs
NCBI-GeneID: 663582
NCBI-ProteinID: XP_008192652
UniProt: D2A142
Position
LG4:8477852..8482720
AA seq 512 aa
MSKQVLEEQIKAQGEIVRKYKAAKESKEKIAEEVSKLLELKAKLNEDESLAAGPQKFTLK
TPKGTRDFSPEQMALRNTVLDKIISVFKKHGAETIDTPIFELKEVLTGKYGEDSKLIYDL
KDQGGEILSLRYDLTVPFARYLAMNKITNIKRYHIAKVYRRDNPSIARGRYREFYQCDFD
IAGAYDPMIPDTECVKIVYEILKVLGMDQFTIKLNHRLLLDGLFEACGVPKDKFRSICSA
VDKLDKSPWSEVKKEMVEEKGLEESVADLIGEYVQLNGQEDLVEKLLKDERLLKSKLAVE
GLEAIKLILHYCAFYNISDKISFDLSLARGLDYYTGIIYEAVLAGDAGGDSEFSVGSIAG
GGRYDNLVSMFDSKHKQVPCVGVSIGIERIFAVLEAKYAAANKKIRTTEVQVYVASAQKN
LVEERMKLCNHLWDEGFKVEHSYKKNPKLLVQLQHCEEYGIPLAVILGESEIQRGVVKLR
EVKSRNEVEVPRTQLADEIRKMLQKSCMNGTL
NT seq 1539 nt   +upstreamnt  +downstreamnt
atgtccaaacaagtcttggaagagcaaatcaaagcacagggtgaaattgtgaggaaatac
aaagctgccaaagaaagcaaagaaaagatcgctgaagaagtcagtaagttgctagaatta
aaggccaaattgaacgaggatgaatctctagcagctggtccgcagaaattcaccctcaag
acaccaaaggggaccagagatttttctccggaacagatggccttaaggaacactgttctg
gacaaaatcatatcagtattcaagaaacacggagcagagaccatagatacgcccattttt
gagctgaaagaagtattaacgggtaaatacggggaagactcgaaattaatttacgacttg
aaagaccaaggtggcgaaatcctttcgctgcgctatgacttgaccgttccttttgcccgg
tatttggcaatgaacaaaatcacgaatatcaagcggtaccacattgctaaggtctaccgc
agggacaatccctcgattgccagggggcgctatagggaattttatcaatgcgattttgat
attgctggcgcctacgatccgatgatccctgacactgaatgcgttaaaatcgtttatgaa
attttgaaagtgttaggaatggatcaattcactattaagttgaatcaccggttgcttttg
gacggactgtttgaggcttgcggcgttccgaaggataaatttcggtcgatttgctcagct
gtggataaattggataagtcaccttggagcgaagtaaaaaaagaaatggttgaggaaaaa
gggttagaggagagcgtagctgacctgattggtgagtacgtccaactcaatggccaagaa
gacctcgttgagaagttattaaaagacgagagactgctcaaaagtaaattagcggtcgag
ggtctggaagcaatcaaattgattttgcactattgcgccttttacaacatctccgacaaa
atttcgtttgatcttagcctagccagaggactggattactacaccgggatcatctacgag
gctgttttagcaggtgatgcaggcggtgactcggaattctccgtgggttctattgctggc
ggcggccgctatgacaacctcgtcagtatgtttgactccaaacacaaacaggttccttgt
gtcggcgtctcaatcggtatcgagcgcatttttgccgtccttgaggccaaatatgcagcc
gcgaataaaaaaattcgaactaccgaagttcaagtttacgttgcatcagctcagaagaat
ctggttgaggagagaatgaaactttgtaaccatttatgggatgaaggatttaaagttgag
cattcgtacaagaaaaatcccaaactgttggtgcagttgcaacactgtgaagagtacggg
attccgctagctgttattttaggggagtccgaaattcagagaggtgttgttaagttgcgc
gaggtgaagtcgaggaatgaagtggaggttccgcgtacgcaactggccgacgaaattagg
aaaatgttgcagaagtcgtgtatgaacggaacgttgtaa

DBGET integrated database retrieval system