KEGG   Tribolium castaneum (red flour beetle): 663588
Entry
663588            CDS       T01046                                 
Name
(RefSeq) synaptosomal-associated protein 25
  KO
K18211  synaptosomal-associated protein 25
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:tca04131]
    663588
Membrane trafficking [BR:tca04131]
 SNARE
  SNAP-25 (Qb,c)
   SNAP-25
    663588
SSDB
Motif
Pfam: SNAP-25 DUF5089 V-SNARE_C SNARE BORCS6 Sec20
Other DBs
NCBI-GeneID: 663588
NCBI-ProteinID: XP_008196404
UniProt: D6WT89
Position
LG7:complement(13485654..13493062)
AA seq 211 aa
MPAPAPVAENGAPRTELQELQLRAGQVTDESLESTRRMLALCEESTDAGAKTMEMLHHQG
EQLDRIEDGMDQINADMREAEKNLTGMEKCCGLCVLPCQKGSSFKEDEGTWKGNDDGKVV
NNQPQRMMDDRNGLGPQGGYIGRITNDAREEEMEENMGQVNTMIGNLRNMAIDMGSELEN
QNRQVDRINLKGESNATRIEVANQRAHDLLK
NT seq 636 nt   +upstreamnt  +downstreamnt
atgccggcacctgcaccagtcgccgaaaatggggccccccgaaccgagctgcaggagctc
cagctccgggctgggcaagtcaccgatgagtctctggagagcacccggcgcatgttggca
ctgtgtgaagagagtaccgatgccggcgccaagactatggaaatgctccaccatcaaggc
gagcaactggaccgtatcgaggatggcatggaccaaatcaacgccgatatgcgagaagcc
gaaaagaacctcacggggatggaaaaatgttgcggactgtgcgttttaccatgtcagaaa
gggtcgtcgtttaaagaggacgaaggcacttggaagggtaacgacgacggaaaagtcgtg
aataatcagccgcagagaatgatggacgatcgcaacggtcttgggccgcagggaggatac
atcggacgtatcacaaacgacgcacgcgaggaagaaatggaagaaaacatgggacaggtt
aataccatgatcggaaatttgcgcaacatggccatcgacatgggctcagagttggagaat
caaaacagacaggtcgatcgtatcaatctcaagggcgagtccaatgcaacaaggatagag
gtggccaatcagcgtgcccacgatctcctcaagtag

DBGET integrated database retrieval system