KEGG   Tribolium castaneum (red flour beetle): 663638
Entry
663638            CDS       T01046                                 
Name
(RefSeq) angiotensin-converting enzyme
  KO
K01283  peptidyl-dipeptidase A [EC:3.4.15.1]
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    663638
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:tca04147]
    663638
   04090 CD molecules [BR:tca04090]
    663638
Enzymes [BR:tca01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.15  Peptidyl-dipeptidases
    3.4.15.1  peptidyl-dipeptidase A
     663638
Peptidases and inhibitors [BR:tca01002]
 Metallo peptidases
  Family M2
   663638
Exosome [BR:tca04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   663638
CD molecules [BR:tca04090]
 Proteins
  663638
SSDB
Motif
Pfam: Peptidase_M2
Other DBs
NCBI-GeneID: 663638
NCBI-ProteinID: XP_974768
Position
LG7:11529180..11537689
AA seq 660 aa
MSKIGDLWWVVAVVGLLVEDAWGITDARLVQGTNVNLGEALQFLREYDSEASRICHRVSS
ARWTYSTNMTDFNKRKMIEEQTLQAKFNKLSWKRTMTFDWTRLPDQMVRRQLKFLITNSR
ASLTDEKYNEIYHLISEMKDIYSHIRICPFNSQESLFCDLELEPDVVRIVGNSRNHMELA
HVWREWHDKVGPPMKNKFMRYVQIANQAARMNGFLDAGEEMRYVYEEQNFEIEIAQTWAS
LQPLYRELFTYVRRKLLQFYGPFVVRPEGPLPAHLLGNVWAQDWSKIVDLVAPYPEFKTI
DVTDEMLRQGFTPLRMFQMAEEFYTSLGLKPMPPEFWRFSMFEKPNDRKVQCTASAWDFC
NQIDYRIKQCTEVNMDDLISTHHEMAHIQYYLHYSEQPYLYRDGANPGFHEGVSNAISLS
VFNPVHLHRVGLFNENTDSYETNINFLMLMALKKVAFAPFAYLVDAWRYEIFQNGVQNMN
AVWWELRLRYQGLIPPIPRTENHFDAAAKRHIPADIPYMKYYVALLLEFQIHSSMCFASG
HVGPLHNCDIYRSREAGRVLSDLLKVGKARHWKEVIKMLTRGQSDRLSAEAMLQYFQPLM
LWLKVQNRNESVVGWMTSLEEEALFQPFLFATSNKIVFDSNLVIFISITPILINNYMLYK
NT seq 1983 nt   +upstreamnt  +downstreamnt
atgtcgaagattggtgacttgtggtgggttgtggccgttgtgggactgctggttgaggac
gcttggggaatcaccgacgcgagattggtgcagggtacgaacgtaaacttaggcgaagca
ttgcaattcctgcgtgaatacgacagcgaggcctccagaatatgtcaccgcgtcagttcc
gcccgatggacgtactcaaccaacatgaccgacttcaacaaacgcaaaatgatcgaagag
caaaccctccaagccaaattcaacaaactctcctggaagcgcacaatgactttcgactgg
actcgcctcccggaccagatggtcaggcgccagctgaaattcctgataaccaacagccgc
gcgagcctaaccgacgagaaatacaacgagatttaccacctcatctccgaaatgaaggac
atttacagccacatcaggatatgcccgttcaacagccaggagagcctcttctgcgacctg
gagctggagccggacgtggtccggatcgtgggcaattcgcgcaaccacatggagctggcc
catgtgtggcgggagtggcacgacaaggtgggccccccgatgaagaataagtttatgaga
tatgtgcaaatcgccaaccaggccgcgaggatgaacgggtttctggacgcgggagaggag
atgagatatgtgtatgaggagcagaatttcgagattgaaattgcgcagacttgggcgagt
ctgcagccgctgtaccgggaattgttcacttatgtgaggagaaaacttttgcaattttat
gggccctttgtggtccggcccgaggggccgctgcctgcacatcttttggggaatgtttgg
gcgcaggactggagcaagattgtggacttggtggcgccgtatcccgagtttaagactatt
gatgtgactgatgaaatgctgagacagggatttaccccacttagaatgtttcagatggcc
gaagagttctacacatctctcggcctcaagcccatgccccctgaattttggcgtttctca
atgttcgaaaaaccaaacgaccgcaaagtacaatgcacggcaagtgcgtgggacttttgt
aaccaaattgattacagaataaaacaatgtactgaagtaaacatggacgatctaatttca
acacaccacgaaatggcccacattcagtactacctgcactacagcgaacagccctatctg
taccgagacggggccaaccctggcttccacgaaggagtctcgaacgcaatctctctatca
gtcttcaacccggtgcacttgcaccgagtcggcttattcaacgaaaacaccgacagttac
gaaaccaacatcaactttttgatgctgatggctttgaaaaaagtcgcgtttgccccgttt
gcgtatttagtggacgcatggcgttatgaaatttttcaaaacggggtgcaaaacatgaac
gcagtttggtgggaattgcgcctgcgctaccagggattaatccccccaatccctcgcact
gaaaaccacttcgacgccgctgcaaaacgccacattcccgccgatattccgtacatgaaa
tattacgtcgcgcttttgctcgaattccaaattcacagctcgatgtgttttgcttcaggg
catgtggggccgttgcataattgcgatatttaccggtcgagggaagccggacgcgtttta
tcggacttgctaaaagtcgggaaggccagacattggaaagaagtgataaaaatgttaact
agaggacagtcggatcgcctgtctgctgaagcaatgcttcagtacttccagcccttgatg
ttgtggctcaaagtacaaaatcggaatgaaagtgtggtcggatggatgacaagtttggaa
gaggaggctttgttccagccattcttgtttgcaacaagcaacaaaattgtgtttgattca
aatcttgttatattcatttctataactccgattcttataaataactacatgttgtataaa
taa

DBGET integrated database retrieval system