KEGG   Tribolium castaneum (red flour beetle): 663703
Entry
663703            CDS       T01046                                 
Name
(RefSeq) 5-formyltetrahydrofolate cyclo-ligase
  KO
K01934  5-formyltetrahydrofolate cyclo-ligase [EC:6.3.3.2]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00670  One carbon pool by folate
tca01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00670 One carbon pool by folate
    663703
Enzymes [BR:tca01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.2  5-formyltetrahydrofolate cyclo-ligase
     663703
SSDB
Motif
Pfam: 5-FTHF_cyc-lig FAA_hydrolase_N
Other DBs
NCBI-GeneID: 663703
NCBI-ProteinID: XP_008195843
Position
LG7:11511504..11514879
AA seq 213 aa
MKFGGRQKVFSALSLYATMVTKATTKEAVRREISERLKHLTSEEKQTQSKIVFEKLLNLP
SFQKSKRVSTYLSIDNEIDTEPIVRKIFETGKECFVPRYSKAGMEMVKIHSYQDWETLPV
TSWGIKQPGLKEQREDALKTGGLDFVVVPGVGFTAKGLRLGHGGGYYDRYMADLRKNQDV
PPALVGLAFKEQICDDLPVTELDVQIDLVLFPE
NT seq 642 nt   +upstreamnt  +downstreamnt
atgaaatttgggggtcgccaaaaggttttttctgccttatcactgtacgcgacaatggtg
acaaaagcaaccacgaaagaagccgtccgtcgtgaaatcagcgaacggctcaagcacctc
acttctgaagaaaagcaaactcagtcaaaaatagttttcgaaaagttattaaatttacct
tcgttccaaaagagcaaacgtgtgtcaacatacttaagtattgacaatgaaatcgataca
gagccaattgtacgaaaaatattcgaaaccgggaaagaatgttttgttccgagatacagc
aaagctgggatggaaatggtcaaaatacactcgtaccaggactgggagaccctgccggtg
accagctgggggataaaacagccgggtttgaaggagcaaagagaggatgctttaaagaca
ggcggtttggattttgttgttgttccgggggtcggctttaccgccaaaggactcaggcta
gggcatgggggcggttattacgacagatatatggcagacttgaggaaaaatcaggatgtt
ccgccggctcttgtaggtttggcgttcaaggaacaaatctgtgacgatctaccggtcaca
gagctggacgtacagatcgacctggttctgtttcccgaataa

DBGET integrated database retrieval system