KEGG   Tribolium castaneum (red flour beetle): 663905
Entry
663905            CDS       T01046                                 

Symbol
Tiap2
Name
(RefSeq) inhibitor of apoptosis 2
  KO
K16060  baculoviral IAP repeat-containing protein 2/3
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04120  Ubiquitin mediated proteolysis
tca04215  Apoptosis - multiple species
tca04624  Toll and Imd signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    663905 (Tiap2)
 09140 Cellular Processes
  09143 Cell growth and death
   04215 Apoptosis - multiple species
    663905 (Tiap2)
 09150 Organismal Systems
  09151 Immune system
   04624 Toll and Imd signaling pathway
    663905 (Tiap2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:tca01002]
    663905 (Tiap2)
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:tca04121]
    663905 (Tiap2)
Peptidases and inhibitors [BR:tca01002]
 Peptidase inhibitors
  Family I32: IAP family
   663905 (Tiap2)
Ubiquitin system [BR:tca04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   Other single Ring-finger type E3
    663905 (Tiap2)
SSDB
Motif
Pfam: BIR zf-C3HC4_3 Prok-RING_4 zf-RING_5 Retrotran_gag_4 zf-RING_2 zf-C3HC4_2
Other DBs
NCBI-GeneID: 663905
NCBI-ProteinID: NP_001280519
UniProt: D6WAN9
Position
LG2:12382998..12387060
AA seq 494 aa
MNVEQNRLDTFEEWPQDAAVSPPRIAKAGFFYTKHDVTVECFSCHLTISEWNYGDQVMAK
HKTLNPSCPFVLNPTTSGNVPIISPTNVPSTSDSMKDEAVRLKTFAKWPKPHIVAPERLA
RAGFYYLNTGDNTKCAFCKGVVRAWEPGDDPDQEHKRHFEDCPFVLTEIVPRLSQNTNGQ
VKTDSSSFTNLHLVANENLHCLGVQTHKGPKKPNYATLESRLRSFATWPPDLIQTPDILS
QAGFYYEGMGDQVRCFHCDGGLRHWDPQDDPWTEHARWFPRCSFIKLVKGQEFVTACSLE
LNVNSNLEEVDQKNYPSVQSRKREVTEQEIQEHMLGEVALSALSIGLNVERVKRAIREKL
EQTGRGYSQPDALVEAALNLQHSEEDLSDDQDTHVKNVVENVLDNIIARSCSSEIKTENE
PIVKESRSNKTLSLEEENRILKEARLCKICMDAEVGIVFLPCGHLTTCVNCAPNLEDCPL
CRSAIKATVRTFLS
NT seq 1485 nt   +upstreamnt  +downstreamnt
atgaacgtggaacagaaccgtttggacacgttcgaagagtggcctcaagacgccgctgtg
tcaccccctcgaatcgccaaagccggttttttctacaccaagcacgacgtcaccgtcgaa
tgcttctcctgccacttgacaatttcggaatggaactacggcgaccaagtaatggccaaa
cacaagaccctcaacccttcttgccccttcgttttaaacccaactacctcaggaaatgtt
cctataatatcacctacaaacgtaccttccacctccgactcgatgaaggacgaggccgtc
cggctcaaaaccttcgccaagtggcccaagccccacatcgtggcccccgagcgcctcgcc
cgcgccggcttctactatctcaacacgggcgacaacaccaagtgcgccttctgcaagggg
gtggtgcgggcgtgggagccgggcgacgaccccgaccaggagcacaagcgccacttcgaa
gactgccctttcgtcctcaccgaaatcgtccccagactcagccaaaacaccaacggacaa
gtcaagacagactcgtcgtctttcaccaatctgcatctagtcgccaacgaaaatttgcac
tgtctgggagtccagacgcacaaaggccccaaaaaacccaactacgccaccctcgaatcg
cggctgagatccttcgccacgtggccccctgacctgatccaaaccccagatatcctctcc
caagccgggttctactacgagggaatgggggaccaggtcaggtgcttccactgcgacggc
ggcctcagacactgggacccccaggacgatccctggacggagcacgccaggtggttcccc
aggtgctccttcatcaagctggtcaaggggcaggaattcgtcaccgcctgctccctcgaa
ctcaacgtcaacagcaacctggaggaggtcgaccagaagaactacccgagtgtccagtcg
cgaaagcgcgaggtcaccgagcaagaaatccaggagcatatgttgggggaagtggccctg
tcggcccttagcatcggcttgaatgtcgaaagggtgaaaagggcgattcgggagaagttg
gaacagactggccgcggctactcacagccggacgctttggtcgaagccgctctcaatctc
cagcacagcgaggaggacttgtccgatgatcaggacactcacgtgaagaatgtcgtagaa
aatgttttagataatataattgcacggagttgttcgagtgagattaaaacggaaaacgaa
ccgatagttaaggaatcaagatccaataaaactttatcgctagaagaagaaaatcgaatt
ctgaaagaggcaagactgtgtaagatttgtatggacgccgaggtcggtatagtgtttctg
ccgtgcggacatttaacgacgtgtgttaattgtgcaccgaatttggaagattgccctcta
tgtagatccgccatcaaggccactgttagaacgtttttgtcataa

DBGET integrated database retrieval system