KEGG   Tribolium castaneum (red flour beetle): 664125
Entry
664125            CDS       T01046                                 

Definition
(RefSeq) U1 small nuclear ribonucleoprotein C
  KO
K11095  U1 small nuclear ribonucleoprotein C
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    664125
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    664125
Spliceosome [BR:tca03041]
 Complex A
  U1 snRNP components
   U1 snRNP specific factors
    664125
 Complex B
    664125
SSDB
Motif
Pfam: zf-U1
Other DBs
NCBI-GeneID: 664125
NCBI-ProteinID: XP_975233
UniProt: D6W9X3
Position
LG2
AA seq 153 aa
MPKYYCDYCDTYLTHDSPSVRKTHCTGRKHKDNVKFYYQKWMEEQAQHLIDATTAAFKAG
KIANNPFAQPGKGVAIPPPAQLTAMGQRPGAPGAPMMPPTMGPGGPMPPMMMGPHGPMPP
MMGMRPPMMGMMPMGPMGPMGVRPPVVNPQMKS
NT seq 462 nt   +upstreamnt  +downstreamnt
atgccgaagtattattgtgactattgtgatacatacttgactcacgactcccccagtgtg
cggaaaacgcactgcacgggtcggaagcacaaagacaatgttaaattttattatcaaaaa
tggatggaagagcaagcacaacatttaatcgacgctacgacagccgccttcaaagcgggc
aaaatcgcaaataacccatttgcccagcctggtaagggtgtggcgatacctccccctgca
caactcacagctatgggccaaaggcctggggcaccgggggctcccatgatgccaccaacg
atgggcccaggaggacctatgcccccgatgatgatggggccacatgggcccatgccgcca
atgatgggtatgcggccgcccatgatgggcatgatgccgatggggcctatggggcccatg
ggcgtcaggccgcccgtggtcaatccgcaaatgaagagctaa

DBGET integrated database retrieval system