KEGG   Tribolium castaneum (red flour beetle): 664163Help
Entry
664163            CDS       T01046                                 

Definition
(RefSeq) calcineurin subunit B type 2
  KO
K06268  serine/threonine-protein phosphatase 2B regulatory subunit
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca04310  Wnt signaling pathway
Brite
KEGG Orthology (KO) [BR:tca00001]
 Environmental Information Processing
  Signal transduction
   04310 Wnt signaling pathway
    664163
Protein phosphatases and associated proteins [BR:tca01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     664163
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EF-hand_1 EF-hand_7 EF-hand_5 EF-hand_6 EF-hand_8 SPARC_Ca_bdg EF-hand_4 EF-hand_9 DUF1398
Motif
Other DBs
NCBI-GeneID: 664163
NCBI-ProteinID: XP_975270
UniProt: D2A3E7
Position
LG4
AA seq 170 aa AA seqDB search
MGNESSLPMELCSNFDADEIRRLGKRFRKLDLDNSGALSIDEFMSLPELQQNPLVQRVID
IFDADGNGEVDFKEFIQGVSQFSVKGDKLSKLRFAFRIYDMDNDGFISNGELFQVLKMMV
GNNLKDTQLQQIVDKTILFADKDEDGKISFEEFCNVVGNTDIHKKMVVDV
NT seq 513 nt NT seq  +upstreamnt  +downstreamnt
atgggtaacgagagctccctgcccatggagttatgctcaaacttcgacgccgatgagata
cgacgcctcggtaagcgattccggaagctagacttggacaattccggggcgctcagcatc
gacgagttcatgtcgctgccggagctccagcagaatcctctggtgcagcgcgtgattgac
atcttcgacgccgacggcaacggcgaggtggattttaaagagtttatccagggagtgtcg
cagttcagcgtgaagggggacaagctctctaagctgcggtttgcgttccgaatttacgac
atggataacgacgggtttatctcgaatggggagttgtttcaagtgttgaaaatgatggtc
gggaacaatttgaaagacacccaactccagcaaatcgtagataagacaattttgtttgcg
gataaagacgaggacggtaagatttcattcgaggagttttgtaacgtggttggcaacact
gacatccacaaaaagatggtggtggatgtgtag

DBGET integrated database retrieval system