KEGG   Tribolium castaneum (red flour beetle): 664325
Entry
664325            CDS       T01046                                 

Definition
(RefSeq) AF4/FMR2 family member 4
  KO
K15195  AF4/FMR2 family member 3
Organism
tca  Tribolium castaneum (red flour beetle)
Brite
KEGG Orthology (KO) [BR:tca00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03021 Transcription machinery [BR:tca03021]
    664325
Transcription machinery [BR:tca03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Others
     664325
SSDB
Motif
Pfam: AF-4_C AF-4 Caskin1-CID
Other DBs
NCBI-GeneID: 664325
NCBI-ProteinID: XP_008192201
Position
LG4
AA seq 1316 aa
MIGGYYDRNPLLKGTLTSVERDRLRERERQARAQMTSQVDDQGTFLFGAPVRVNPSSSDP
VTQQIQSKLGDFQRLRPFLDQKDLIGVDGVPPSPGVPNGPSSRHNPFMSNLASAAVSSRL
QPSPESRPEFKKPHHHQIHHQHQRGGYVKPADGKPPYEGRGGYPGQPVKHGSGITNHRSN
GILPAKGPPQSSPNSSAPLLPSSNSSRLHNSGARNHPRNTTFEQNQGPPAGPREPLPSAT
PNTDMENIFKEMIEVRRPLTAIAATPRKEPDNKFTFSPVFTKLTESTPTPSAPKKREKVA
APRPSTDLRDDLNLSDDSDDDQKQSSKLPVEKMVSPLGATPAVGSFSKMEYPPEPADPAG
SSSSDSGSDSGSESDSSSDDSAEDNVTSSNPSKSNVVPAETGPSSPPPPEEKDKKRWNLG
SYLVIDQNNAKADSVLSPKVQTSPLTSSMLPLAVDKKKVTEESDASDSTKDLDSVVAEAL
ASATVPLLSSFSDSDDSVTERRTKRRKHTIIQSVTKNSESDSDDAERTKKPKPVRRASPR
TKSVDSCSDSDNNSANIIKKRLSPLPHKSPEQLVKPKQSRGRPRKIKPAVSGSDKKPRKR
GRPPKPRPSHPSSSDEEDNVDKRPVRRRTISKRDASSSSDSDSRYRKYESPKKIPKPFED
KIKRPAIKNDSDDDWGKKNKNKLKPRQRSESESSKKNDSPKKEVFRRKGRTSNPHHKSAA
TLPTTTDSSDSDSGPSKRLQRSLSSRSRSRSSDSDTNILAKSPVNKVEETKPIKDKNKSD
TLRKLFTPKRDSEGGKGGGKGGGKGGKGGKGKGGVNVIFADGGNERCVSPVEDETMPTIS
NPTLLSPIPHKEAKPPLASPCAEPIKFIKTEPLDDEKISMKVKIGLNRIDLNAVICLKNK
LEALKHPYFREFEKKKLSDNDNESKKKDSDLAELKHKSKKRKRRNSSSSISSLSTVSNLS
HSSKKLEHRKDRENHKMKRRKDDEIYPRSQSDNISLTNAPPTNHEREGSRSRQVISPVDK
NKSQSTREYHSYFEKPDEPLECEESSYVICRAQSQYLSDATRLKHLADKETDTTKQCMLY
LEAVLFFLLTGNAMELTRVTENACFTMYKDTLSLIRYITSKFRSQHNASSKHNKLAVLSY
RCQALLYYKLFKMKKHEAKDYQKVLSEYFNNKAVAIPPEQQTQQGQGTPSPMSPTPSPAG
SVGSVGSQSSGYSSGELAARGSNVPPPVPSTHAQSGGAHVWIPQNIYNAMYKQNQNFTYL
LSCQDLWDTADALVIKGKHTDFFIDLDRLCKPLTMHSSLIDLVRYIREGIKRLNES
NT seq 3951 nt   +upstreamnt  +downstreamnt
atgatcggaggatactatgaccggaatccgctgctcaaaggcaccctgactagcgtggag
agagaccgcctgcgagagcgggagaggcaggcccgggcccagatgacttcgcaagtggac
gatcaagggacctttctgtttggagcacccgttagggtgaacccgtcctcttcggacccc
gtcacgcagcagatccagagcaagctcggcgacttccagcgactgcggccgttcctggac
cagaaggacctcatcggcgtcgatggcgtcccgccaagtcccggcgtgcccaacgggccg
agctcgaggcataatccgttcatgtcgaatcttgcctcggcggcggtgtcgtcgaggctc
caaccctcaccagaatctcgtcccgaattcaagaaaccacatcaccaccagatacatcac
cagcatcaaagaggcggatacgtgaagccggccgacgggaagccgccctacgaaggcaga
ggcggatatccaggtcaaccggtcaaacacggcagcggcatcacaaatcacaggtccaac
gggatccttccggcgaagggtccgccccagtcgtcgccgaactcgtcggcgccgctcttg
ccgtccagcaactcctccaggttacacaacagtggcgcacgcaatcatccccgcaatact
acgttcgaacagaatcaaggacctccggctggcccgagggaacctttgccttccgctaca
cccaatacagatatggagaacattttcaaggaaatgatcgaagttcgacgtccgctcact
gccatcgctgcaactcccaggaaagagcccgataataagtttaccttcagtcctgttttt
accaagttgacggagtctacgccaacgccgtctgcaccgaagaaacgcgaaaaagtcgca
gctccacgcccgtcaactgacttacgagatgatctaaatctgtcagatgacagcgatgac
gatcaaaagcaatcttccaagttaccagtagaaaagatggtttctccgctgggtgcgact
ccggccgttggtagtttctccaagatggagtatccgccggaaccggcagatccggctggg
tcttcgtcgagcgattcgggctcggattcgggatcagagagcgactcgagcagcgacgat
tcggccgaagacaacgtgacttcgtcgaatccgagcaaatcaaacgtagtacctgccgaa
acgggaccgtcttcgccgcctccgcccgaagaaaaagacaagaagcgatggaaccttggt
tcgtatttggtcatcgaccagaacaacgccaaagcggactccgttctctcaccgaaagta
caaacgtcgccgctcacctccagcatgctccctttggccgtcgacaagaaaaaagttacc
gaagagtcggacgccagtgattcgacgaaagatctagacagtgtggttgccgaggcactg
gcctcggcaacggtgcccctcttgtcgagtttctccgattcggacgatagtgtgacggaa
agacgcacgaaaagacgcaaacataccataatacaatcagttaccaaaaattcggaaagt
gacagtgacgatgccgaacggacgaaaaaaccgaaaccggtgcgacgtgccagtcctcgg
actaaatcagtggattcgtgtagtgattcggacaataacagtgccaatattatcaaaaaa
cgtctatcacctttgcctcataaatcgcccgaacagttagtcaaacccaaacagagtcgc
ggacgtcccagaaaaatcaaaccggctgtgagtggatccgacaagaaaccgcgaaaaagg
ggacgaccaccaaaaccccgaccctcacacccgagcagttccgacgaagaagacaacgtg
gacaaaaggccggtccgacggagaacaatctcgaaacgtgacgcttcgagcagctccgac
tcagactcacggtaccgaaagtacgaatcaccaaagaaaatcccaaaaccattcgaggac
aaaatcaaaaggcccgccatcaaaaacgactcggacgacgattggggcaagaagaacaag
aacaaactgaaaccaagacagaggagcgagtcggaaagctccaagaagaacgactccccc
aagaaggaggtcttccggcggaaaggaagaacgtcaaacccacatcacaaaagcgccgca
actcttcccacaacgaccgattcgagcgacagcgattcgggcccttccaagcgcttacaa
cgaagtctgagttcaaggagtcgcagccggtcctcggacagcgacacgaacattctagcc
aaatccccggtgaataaagtcgaggagacgaaaccgatcaaagacaaaaacaagagcgac
actctacgcaagctgttcactccgaagcgcgactccgagggcggcaaagggggcggcaaa
ggcggcggcaagggcgggaaaggcggcaagggcaaggggggcgtcaatgtgatattcgcc
gacggcggaaacgaacgctgcgtttcgcccgtcgaagacgaaacaatgccgaccatatca
aacccaactctcctatcaccaatcccccacaaggaggccaaacctccactagcatcccct
tgcgccgaaccaatcaaattcattaagactgagcctctcgatgacgagaaaatctcgatg
aaagtcaaaatcggtctgaatcgcatcgacttgaacgctgtgatttgcctcaaaaacaag
ctcgaagcgctgaaacatccctacttccgggagtttgagaagaagaagctgagcgataat
gataacgaaagtaagaagaaggattcggatttggccgaattgaagcacaagtcgaagaag
cgaaagcggcggaacagttcgagctcgatttcgtcgctgtcgacggtcagcaacttgtcg
cacagtagcaagaaactggagcatcgcaaagatcgggagaatcacaagatgaaacggcga
aaagacgacgaaatctatcccagatcacaaagtgataatatcagtctgacgaatgcacca
ccgaccaatcacgagcgggaaggtagcagaagtcggcaggtgatctcgcccgtcgacaaa
aacaagtcgcaaagtaccagggagtatcattcgtactttgagaagcccgacgagccccta
gagtgcgaagagagttcgtatgtgatttgcagagctcaaagtcagtacctgagcgatgcg
actcgtttgaagcacttagctgataaagagactgatacaacaaaacagtgtatgctgtac
ctggaggctgtacttttcttcttactaacgggcaacgccatggaactcacaagggttaca
gaaaacgcctgtttcacaatgtataaagacacattatcgttaataaggtacatcacttcg
aaatttcgaagtcaacataacgcgtcttcgaagcacaacaagctcgctgtgttaagttat
cggtgccaagcgcttctttattataaactattcaagatgaagaagcacgaagcgaaggac
taccagaaggtcctcagcgaatatttcaacaacaaggccgttgcgatccccccagagcag
cagacccagcaaggccagggtacaccgtcgcccatgtcaccgacgccgtctcctgccggt
tctgtgggttcggtgggcagccagtcgtccggctatagcagtggtgagttggcggcgagg
ggcagcaacgtgccgccacctgttccatcaacgcacgcacaaagtgggggcgctcacgtg
tggattcctcaaaatatttacaacgccatgtacaagcagaaccagaatttcacatatctt
ctgtcttgtcaggatctgtgggatacggccgatgcgctcgtcatcaagggcaaacacaca
gatttctttatcgacttggataggctgtgcaagcctctgacgatgcacagctcgctgata
gacctggtgaggtacattcgcgaagggataaaaaggttgaatgagagttag

DBGET integrated database retrieval system