KEGG   Tribolium castaneum (red flour beetle): 664413
Entry
664413            CDS       T01046                                 

Name
(RefSeq) splicing factor 3B subunit 2
  KO
K12829  splicing factor 3B subunit 2
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03040  Spliceosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09121 Transcription
   03040 Spliceosome
    664413
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03041 Spliceosome [BR:tca03041]
    664413
Spliceosome [BR:tca03041]
 Complex A
  U2 snRNP components
   U2 snRNP specific factors
    664413
 Complex B
    664413
 Complex C
   U2 SnRNP specific factors
    664413
SSDB
Motif
Pfam: DUF382 PSP
Other DBs
NCBI-GeneID: 664413
NCBI-ProteinID: XP_008195938
UniProt: D6WR66
Position
LG7:10538598..10542109
AA seq 694 aa
MNPDQLQEGVPEHPVPHQEGMFGSGMQGWAGEHGVGGEKQLPSLLSLKVDPPDQMMETPP
TEVVLPQVLEEVLALKNQRARELEREETETVVQQPQTPREALWEKDDNIEPVVENEEESQ
VKETTKISKNKKKKKRKKNKKNRENEQNKAAEEEEKKDGQEDGNTDVEVEYVQETISLLE
LAPQYRQFYSIFDVFKITDQKHDIPPPVLATPTSLSSKSMLNSIGDHFQEEMEDGDDKKL
DDKSKMSKRKLKKLTRLSVAELKQLVSRPDVVEMHDVTARDPKLLVQLKAHRNTVQVPRH
WCFKRKYLQGKRGIEKPPFNLPDFIKRTGIMEMRASLQDKDESKTLKAKMREKTRPKLGK
IDIDYQKLHDAFFKWQTKPKMTIHGDLYYEGKEFETRLKEKKPGDLSEELRTALGMPVGP
NANKVPPPWLIAMQRYGPPPSYPNLKIPGLNAPIPDGCAFGYHAGGWGKPPVDENGKPLY
GDVFGTNVTNIDDIGEDPSVDRTLWGELESESEEEDEEEEEDQDNQQNAADESGLVTPAE
GLVTPSGLTSVPTGMETPEAIELRKKKIESEMEQGENPILYHVIPEKRNERIGGSMMGSS
HVYDMSAVGAAPATSRKPGDKEGMVELALDPSELDMDSDAMAVRYEQQMRENQSQLQKED
LSDMLAEHVAKQKNKRKRQQQDTKQTKKYKEFKF
NT seq 2085 nt   +upstreamnt  +downstreamnt
atgaatccggatcagctacaagagggtgtcccggagcaccctgtgccccaccaggaaggg
atgtttgggtcaggtatgcaagggtgggctggtgaacatggtgttggtggtgaaaaacaa
ctcccctcattgctatccctaaaagtggatcctcctgatcagatgatggagacgccacca
actgaagttgttttacctcaagtgttggaagaggtgttggcgttaaaaaatcagagagcg
cgtgaactagaacgagaagaaacggaaacagtagttcaacagccgcagactcctagagag
gcgctttgggagaaagatgacaatattgaacccgtggttgaaaatgaagaagagagtcag
gtgaaagagaccaccaaaatcagtaagaataaaaagaagaagaaaaggaagaagaacaag
aaaaacagggagaatgaacagaataaagcggctgaagaggaggagaaaaaggatgggcaa
gaggatgggaatacagatgtggaagttgagtacgtccaagagacgattagtcttcttgaa
ctggctccacaataccggcagttttatagcatttttgacgtgtttaaaataactgatcaa
aagcatgatatcccacccccagttctggcaacgccaacatcattgtcaagtaaatcaatg
ttaaatagcataggagatcactttcaggaagaaatggaagatggggacgacaaaaagctt
gacgataagtcaaaaatgtccaaaagaaagcttaaaaaattgacgcgacttagcgtcgcc
gagcttaaacaactagtcagtagaccagacgttgtagaaatgcacgatgtaacagccagg
gacccaaaattgttggtccaattgaaagctcacagaaataccgttcaggtaccacgtcat
tggtgtttcaaacgaaagtacttgcaaggtaaacgtggtatagagaaaccaccttttaat
cttccagatttcattaaaaggactggaatcatggaaatgcgtgcgtcattgcaagataag
gatgaatccaaaacactcaaagctaaaatgcgggaaaagaccagacccaaacttggaaaa
atcgatattgattatcaaaaattacacgacgcatttttcaagtggcaaactaaacccaaa
atgaccatccatggggacctttattacgagggcaaagagtttgaaaccagattgaaggaa
aaaaagcctggagatttatcagaagaattaagaacggccttaggaatgcctgtgggccct
aacgctaataaagtacccccaccatggttgattgcaatgcaacgttatggtcccccaccc
agctaccccaacttgaaaattccgggattaaatgcccccatccctgatggttgtgccttt
gggtaccatgccggtgggtggggaaaaccaccggtggacgaaaatggaaaaccattgtac
ggtgatgtgtttggaacaaatgttaccaacatagatgacattggtgaggacccttccgtg
gatcgcaccctctggggcgagctcgagtccgaatcagaggaggaggatgaggaagaggag
gaagaccaagacaaccaacaaaacgccgctgacgaatccggtcttgttactccagctgag
ggcttggtgacacctagtggtctcacaagcgtgccaactggcatggaaacacccgaagct
atagaattgaggaaaaagaaaatcgagagcgaaatggaacagggtgaaaacccgattttg
tatcatgtcattcccgaaaaacgcaatgagagaataggtggttccatgatggggagcagc
cacgtttacgacatgtctgctgtgggcgcagcccctgcaactagtcgcaaaccaggggac
aaggaaggaatggttgagttggctcttgatccgtctgagttggatatggatagcgatgca
atggcggttcgttacgaacaacaaatgagggaaaaccagtcacagctgcagaaggaagat
ctcagtgatatgttagctgagcacgtcgccaaacaaaagaataaacgcaagcgccaacaa
caggacacaaaacaaacgaaaaaatacaaagaattcaagttttag

DBGET integrated database retrieval system