KEGG   Tribolium castaneum (red flour beetle): 664430
Entry
664430            CDS       T01046                                 

Name
(RefSeq) 60S ribosomal protein L12
  KO
K02870  large subunit ribosomal protein L12e
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca03010  Ribosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    664430
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:tca03011]
    664430
Ribosome [BR:tca03011]
 Ribosomal proteins
  Eukaryotes
   Large subunit
    664430
SSDB
Motif
Pfam: Ribosomal_L11_N Ribosomal_L11
Other DBs
NCBI-GeneID: 664430
NCBI-ProteinID: XP_975530
UniProt: D6WR75
Position
LG7:complement(10495167..10496130)
AA seq 165 aa
MPPKFDPNEVKLVYLRCVGGEVGATSSLAPKIGPLGLSPKKVGDDIAKGTADWKGLKITV
QLKIQNRQATISVVPSAASLIIKALKEPPRDRKKQKNIKHSGNITLDDVISIARQMRPRS
MAKNLSGTVKEVLGTAQSVGCTIDGKLPHDVIDEVNDGSVEIPEE
NT seq 498 nt   +upstreamnt  +downstreamnt
atgcccccaaagtttgatccaaacgaagttaaactcgtttaccttagatgtgtcggtggt
gaggttggtgccacatcttccttggccccaaaaatcggtcctttgggtttgtctcccaaa
aaagtcggtgatgacatcgctaaaggcaccgctgattggaagggtcttaagataacagtt
caacttaagatccaaaaccgtcaagccactatttctgttgttccatcggccgccagtttg
attattaaagccttgaaagagccaccaagagacaggaagaagcaaaagaacattaagcac
agtggcaacattactttggacgatgttatcagcattgctagacaaatgaggccaagatca
atggctaaaaatctgtctggaacagttaaggaagttttaggtactgcccagtctgtaggt
tgcaccatagatgggaagctcccacatgacgttattgacgaagtgaatgatggctctgta
gaaatacctgaagagtaa

DBGET integrated database retrieval system