KEGG   Tribolium castaneum (red flour beetle): 664564Help
Entry
664564            CDS       T01046                                 

Definition
(RefSeq) glucosylceramidase-like
  KO
K01201  glucosylceramidase [EC:3.2.1.45]
Organism
tca  Tribolium castaneum (red flour beetle)
Pathway
tca00511  Other glycan degradation
tca00600  Sphingolipid metabolism
tca01100  Metabolic pathways
tca04142  Lysosome
Brite
KEGG Orthology (KO) [BR:tca00001]
 09100 Metabolism
  09103 Lipid metabolism
   00600 Sphingolipid metabolism
    664564
  09107 Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    664564
 09140 Cellular Processes
  09141 Transport and catabolism
   04142 Lysosome
    664564
Enzymes [BR:tca01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     664564
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_30 Glyco_hydro_30C Glyco_hydro_59
Motif
Other DBs
NCBI-GeneID: 664564
NCBI-ProteinID: XP_975653
UniProt: A0A139WEE1
Position
LG7
AA seq 502 aa AA seqDB search
MWIIIFFLIGTTLAEECRKRDYGNGGHVCVCTSKHCDTVAYPERVEQPEFLIYTSNKAGL
RFHKSSGTFTKTDQVSDNQILINSNEKYQTMLGWGGAFTDATGINIDSLDEDAQTKLLES
YFSEDGIEYSLCRVPIGGTDFSERGYSYADGHADETLGHFRLAPEDFDYKIPFIKKAQDM
SKGKLQLFASAWTAPKWMKTNGEYAGFGFLKEKMFQAWADYFVKFLENYKSHGIQFWGLT
TGNEPSLGIAPFSKINSVGWTPIMMSNWVRNHLGPTIRNSSFADIKIITLDDQRFFLPWF
INIVFRNKAAKNYIDGIAVHWYYDTVFPASLLKQTHDNYPDKFLLATEACRGEKAGEKDV
NLGSWERGESYAFDIIEDVTHWVSGWVDWNMALDLKGGPTYIKNYVDSPIIVNSTAGEFY
KQPMFYSLGHFSKFVPKNSVRIGSSGFDDHVPVAAFQRPDHGTVVVILNKKDHVVPVTLV
DDSKGSIQVDLSKKSITTILYW
NT seq 1509 nt NT seq  +upstreamnt  +downstreamnt
atgtggattataatcttctttctcattggtactacccttgcggaagaatgtcgcaaaagg
gattacggtaacggcggacatgtctgtgtttgcacttcaaaacactgtgacactgttgca
tatcctgagagagtggaacaacctgaattcctaatttacacctccaacaaagccggttta
agattccataaatcgagcggtactttcactaaaaccgatcaagtgtctgacaaccaaatc
ctcattaattccaatgaaaagtaccaaactatgctcggatggggtggtgcctttaccgac
gccaccggaataaatatcgactcattagatgaagacgctcaaacgaaattgctagagtcg
tatttttccgaagatggtattgaatacagtttgtgtagagtaccaattggaggcactgat
ttttcggaacggggctattcctacgctgatggacatgcagatgaaacactgggacatttc
cgattagctcccgaagattttgattacaaaattccgttcatcaaaaaagcacaagatatg
agcaaaggcaaattgcaacttttcgcttcggcttggacagcacccaaatggatgaaaacg
aatggggaatacgccggttttggttttttgaaagagaaaatgtttcaagcgtgggctgac
tattttgtgaaatttttggaaaattataaatcacacgggatacagttttgggggctgaca
acagggaacgaaccaagtttaggcattgcaccatttagcaaaattaattcagtcggatgg
acacccataatgatgtccaattgggtcagaaatcacttgggaccaactattcgaaattcg
agcttcgccgacatcaaaataatcactctcgatgaccaacgattttttcttccttggttt
atcaatattgtttttaggaacaaagctgccaagaattacatcgacggcattgcggtgcac
tggtactacgacactgtctttcctgcaagtttactgaaacaaacgcacgataattatccc
gacaaatttttgttggctactgaggcttgtcgaggtgaaaaagctggtgaaaaagacgtc
aatttaggttcgtgggaacgtggagaaagttacgcttttgacattattgaggatgttacc
cactgggtgagcggttgggttgactggaacatggccctcgacctaaaaggaggacctact
tatataaaaaactacgtagattctccaatcattgttaattctacggctggtgaattttac
aaacaacccatgttttatagtttagggcatttctcgaaatttgtccctaaaaattcagta
cgaattggatcgtcagggtttgatgaccacgttcctgtcgcagcgttccaaaggccggat
cacggtactgtcgtagtgattttaaacaagaaagaccacgtagtaccagtcacgttagtc
gacgattccaaaggtagtatccaagtcgatctcagcaaaaagtccataacgactatcttg
tattggtaa

DBGET integrated database retrieval system